KEGG   Rattus norvegicus (rat): 24586
Entry
24586             CDS       T01003                                 

Gene name
Ncam1
Definition
(RefSeq) neural cell adhesion molecule 1 precursor
  KO
K06491  neural cell adhesion molecule
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno05020  Prion disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24586 (Ncam1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    24586 (Ncam1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24586 (Ncam1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    24586 (Ncam1)
   04090 CD molecules [BR:rno04090]
    24586 (Ncam1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24586 (Ncam1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    24586 (Ncam1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    24586 (Ncam1)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  NCAM1/2
   24586 (Ncam1)
CD molecules [BR:rno04090]
 Proteins
  24586 (Ncam1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   24586 (Ncam1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  24586 (Ncam1)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_6 Ig_5 C1-set Adeno_E3_CR1 Collagen_bind_2
Other DBs
NCBI-GeneID: 24586
NCBI-ProteinID: NP_113709
RGD: 67378
Ensembl: ENSRNOG00000031890
UniProt: P13596
Structure
PDB: 
1EPF 1QZ1 1LWR 3NCM

Position
8
AA seq 858 aa
MLRTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMF
KNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGF
PEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDAS
IHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRP
EKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQ
GPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPD
SENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVP
ILKYKAEWKSLGEEAWHSKWYDAKEANMEGIVTIMGLKPETRYAVRLAALNGKGLGEISA
ATEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVKYRALASEWKPEI
RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTAGLS
TGAIVGILIVIFVLLLVVMDITCYFLNKCGLLMCIAVNLCGKAGPGAKGKDMEEGKAAFS
KDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVETKSEPQESEAKPAPTE
VKTVPNEATQTKENESKA
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgctgcgaactaaggatctcatctggactttgtttttcctgggaactgcagtttccctg
caggtagatattgttcccagccaaggagaaatcagcgttggagagtccaaattcttcctg
tgtcaagtggcaggagatgccaaagataaggacatctcctggttctcccccaacggggag
aaactgagcccaaaccagcagcggatctcagtggtgtggaacgatgatgactcctctacc
ctcaccatctacaacgccaacattgatgatgccggcatttacaagtgcgtggtcaccgct
gaagacggcacccagtccgaggccactgtcaatgtgaagatcttccagaagctcatgttc
aagaatgcgccaaccccacaggagtttaaggaaggggaagatgctgtgattgtctgtgat
gtggtcagctctctgcccccaaccatcatctggaaacacaaaggccgagatgtcatcctg
aaaaaagatgtccggttcatagtcctatccaacaactacctgcagatccgaggcatcaag
aaaacagatgagggcacttaccgctgtgaaggcaggatcctggcccggggggagatcaac
ttcaaggacattcaggtcattgtgaatgtaccacccactgtccaggccagacagagcatc
gtgaatgccactgccaacctgggccagtctgtcaccctggtgtgtgatgccgatggcttc
ccagagcccaccatgagctggacaaaggatggggaacccatagagaatgaggaggaagat
gacgagaagcacatcttcagtgacgacagttcggagctgaccatcaggaatgtggacaaa
aatgacgaagccgaatacgtctgcatcgctgagaacaaggctggcgagcaggatgcctcc
atccacctcaaggtcttcgcaaagcccaaaatcacctatgtagagaatcagacagccatg
gaactagaggagcaagtcactctgacatgtgaagcctccggagaccccattccttccatc
acctggagaacgtccacccgaaacatcagcagtgaagaaaaggcatcgtggactcgacca
gagaagcaagagactctagatgggcacatggtggtacgcagccatgctcgtgtgtcctcc
ctgaccctgaagagcatccagtacacagatgctggagaatacatctgcactgccagcaac
accatcggccaggactcccagtccatgtaccttgaagttcaatatgctcccaagctccag
ggccctgtagctgtgtacacttgggaagggaaccaggtgaacatcacctgtgaggtcttt
gcctacccaagtgccacaatctcctggttccgagatggccagttgctgccaagctccaac
tacagcaatatcaagatctacaacaccccatctgcgagctatctggaggtaacccctgat
tccgaaaatgactttggaaactacaactgcacagcggtgaaccgtattggacaggagtcc
ttggaattcatcctggttcaagcagatacaccatcttccccatccatcgaccgggtggaa
ccatactccagcacagcacaggtacaatttgatgagccagaagccacaggtggagttccc
atcctcaaatacaaggctgagtggaagtcgctgggtgaagaagcatggcattccaagtgg
tatgatgccaaagaagccaacatggaagggattgtcaccatcatgggcctgaagcctgag
acaaggtacgcggtacgactggcggccctcaacggcaaggggctgggcgagatcagtgca
gccactgagttcaagacacagccagtccgggaacccagcgcacccaagctggaagggcag
atgggagaggacgggaactccatcaaggtgaacctgatcaagcaggatgacggcggctcc
cccatcagacactatctggtcaagtacagagcgctcgcctccgagtggaaaccagagatc
aggctcccgtccggcagtgaccacgtcatgctcaagtccctagactggaacgccgagtac
gaagtatatgtggtagctgagaaccagcaaggaaaatccaaggcagctcacttcgtgttc
aggacttcagcccagcccacggccatcccagccaatggcagccccactgcaggcctgagc
acaggcgccattgtgggcatcctcattgtcattttcgtcctactcctggtggtcatggac
atcacctgctacttcctgaacaagtgtggcctgctcatgtgcatcgctgttaacctgtgc
ggcaaagcggggcccggagccaagggcaaagacatggaggagggcaaggctgctttctcg
aaagatgagtctaaagaacccattgtagaggtccgaacggaggaggaacggactccaaac
catgacggagggaagcacacagagcccaacgagaccacaccactgacagagcccgagaag
ggtcctgtagaaacaaagtccgagccccaggagtcagaagcaaagccagcgccaactgaa
gtcaagacggtccccaatgaagccacacaaacgaaagagaatgagagcaaagcatga

KEGG   Rattus norvegicus (rat): 288280
Entry
288280            CDS       T01003                                 

Gene name
Ncam2
Definition
(RefSeq) neural cell adhesion molecule 2 precursor
  KO
K06491  neural cell adhesion molecule
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno05020  Prion disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    288280 (Ncam2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    288280 (Ncam2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    288280 (Ncam2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    288280 (Ncam2)
   04090 CD molecules [BR:rno04090]
    288280 (Ncam2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    288280 (Ncam2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    288280 (Ncam2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    288280 (Ncam2)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  NCAM1/2
   288280 (Ncam2)
CD molecules [BR:rno04090]
 Proteins
  288280 (Ncam2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   288280 (Ncam2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  288280 (Ncam2)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_6 Ig_C17orf99 Ig_5 Ig_4 Izumo-Ig Adeno_E3_CR1 Pur_ac_phosph_N Herpes_gE
Other DBs
NCBI-GeneID: 288280
NCBI-ProteinID: NP_981954
RGD: 1303131
Ensembl: ENSRNOG00000002126
UniProt: Q6RKB3
Position
11
AA seq 837 aa
MSLLLSFYLLGLLVSSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEK
IISTQRVMLQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREV
LSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTIPDNRFAVLANNNLQILNINKSD
EGIYRCEGRVEARGEIDFRDIIVIVNVPPAIVMPQKSFNATAERGEEMTLTCKASGSPDP
AISWFRNGKLIEENEKYILKGSNTELTVRNIINKDGGSYVCKATNKAGEDQKQAFLQVFV
QPHILQLKNETTSENGHVTLICEAEGEPVPEITWKRAIDGVTFSEGDKSPDGRIEVKGQH
GRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEYAPKFVSNQTMYYSWEGNPINI
SCDVKANPPASIHWRREKLVLPAKNTTHLKTHSVGRKMILEIAPTSDNDFGRYNCTATNR
IGTRFQEYILELADVPSSPRGVKIIELSQTTAKISFNKPESHGGVPIHHYQVDVKEVTSE
TWKIVRSHGVQTTVVLSSLEPNTTYEVRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIH
GQPSSGKSFKISITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTM
GYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAIIGLGVAALLLILVVTD
VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERIT
NHEDGSPVNEPNETTPLTEPEKLPLKEENGKEVLNAETIEIKVSNDIIQSKEDDIKA
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgagcctcctcctctccttctacctgctcgggttgcttgtcagtagcgggcaagctctt
cttcaagtgacaatttcacttagcaaagtagagcttagtgtgggtgaatctaaattcttc
acatgtacagcaattggcgagcctgagagtatagactggtacaaccctcaaggagagaag
atcatttcaacgcagagggttatgctacagaaggagggcgtcaggtctcgactaaccatc
tacaatgccaacatagaagatgcaggaatatatcgctgtcaagcgacagatgccaaaggg
cagacgcaggaagctacagtagttttggaaatttaccaaaaactcaccttcagagaagtg
ctgtcccctcaagagttcaagcaaggggaggatgcagaagtggtttgcagagtgagcagt
tcccccgcccctgcggtcagctggctgtatcacaatgaggaagtcaccaccatccccgac
aatcggtttgctgtgcttgcaaacaataatttgcagatcctcaacatcaataaaagtgat
gaaggtatatacagatgtgaaggaagagtggaggccaggggagagattgacttccgggac
attattgttattgtaaacgttccgccagcaatcgtgatgccccaaaagtccttcaatgcc
actgcagagagaggagaagagatgaccttaacctgcaaggcctcgggctccccagatccc
gccatctcttggttcaggaatggcaaactcattgaagaaaatgaaaagtatattttaaag
ggcagtaatacagagctcacggtcagaaacataatcaataaagatgggggctcttatgtc
tgcaaagccacaaataaggcaggggaagatcagaagcaggccttccttcaagttttcgtg
cagcctcatatattacaactcaagaatgagacaacgtctgaaaatggtcacgtcacactc
atctgtgaagcagaaggggagcctgttccagaaatcacatggaaaagagccatagacgga
gtcacattttctgaaggtgacaagagcccagatggccgcatcgaagttaaagggcagcat
ggccgatcttcactgcacatcagagatgtgaagttgtcagattcgggaagatatgactgt
gaggccgcgagtagaattggcgggcaccagagaagcatgcatcttgacatcgaatatgct
cctaagtttgtttcaaatcagacaatgtattactcttgggaaggaaatccaatcaatata
agttgtgatgtgaaagcaaatccacctgcctcaatccactggagaagagagaaattggtc
ttaccagctaaaaataccactcatttaaaaactcacagtgtgggaagaaagatgatactt
gagattgcccctacatcagacaatgactttggacgatataactgcactgcgactaaccgt
ataggcacgagattccaggagtatattcttgagttagcagatgtcccctctagtccccgt
ggagtgaagattatagagctgtcacagaccacagccaagatctctttcaataaacccgag
tcccatggaggtgtgcccattcatcactaccaagtggatgtcaaggaagtgacatcagaa
acctggaagatagtacgctcccatggagttcaaacgacagttgttttgagcagcctggaa
ccaaatacaacatatgaagtcagggttgcagcagtgaatggcaaaggacaaggagactac
agtaaaatagaaatattccagacactgccagttcgtgagccaagtcccccttccatacat
ggacagccaagcagtgggaagagttttaaaatcagcatcaccaagcaagatgatggaggg
gctcccattttagaatacattgtgaaatacagaagtaaagacaaggaagatcagtggcta
gagaagaaggtgcagggaaataaagaccacattatcttggagcatctgcagtggacaatg
ggttatgaagttcaaatcacagctgccaacagacttgggtattctgagccgactgtatat
gagttcagcatgcctccaaagcccaacattattaaagacacactttttaatggcctaggc
ctcggagccatcattggccttggagtcgctgcccttttgctaatccttgtggtaacagat
gtcagctgcttcttcattcgacaatgtgggttgttaatgtgcatcaccagaagaatgtgt
gggaaaaagagtggctccagtggaaaaagtaaagaacttgaagaaggaaaagcagcttac
ctgaaagatggatcaaaagaaccaatagtggaaatgagaacagaggatgaaagaatcact
aaccatgaagacgggagtccagtaaatgagccaaatgaaaccacaccactaacagaacct
gaaaaattgcctttaaaagaagaaaatggaaaagaagttttaaatgcagaaactatagaa
attaaagtgtctaatgacatcatccagtctaaagaagatgacatcaaggcataa

DBGET integrated database retrieval system