KEGG   Rattus norvegicus (rat): 24587
Entry
24587             CDS       T01003                                 

Gene name
Nefh
Definition
(RefSeq) neurofilament heavy polypeptide
  KO
K04574  neurofilament heavy polypeptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    24587 (Nefh)
   05022 Pathways of neurodegeneration - multiple diseases
    24587 (Nefh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    24587 (Nefh)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type IV
     24587 (Nefh)
SSDB
Motif
Pfam: DUF1388 Filament RasGAP_C
Other DBs
NCBI-GeneID: 24587
NCBI-ProteinID: NP_036739
RGD: 3159
Ensembl: ENSRNOG00000008716
UniProt: F1LRZ7
Position
14
AA seq 1064 aa
MMSFGGADALLGAPFAPLHGGGSLHYALSRKAGAGGTRSAAGSSSGFHSWARTSVSSVSA
SPSRFRGAGAASSTDSLDTLSNGPEGCVVAAVAARSEKEQLQALNDRFAGYIDKVRQLEA
HNRSLEGEAAALRQQQAGRAAMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAH
VRQRLDEEARQREEAEAAARALARFAQEAEAARVELQKKAQALQEECGYLRRHHQEEVGE
LLGQIQGCGAAQAQAQAEARDALKCDVTSALREIRAQLEGHTVQSTLQSEEWFRVRLDRL
SEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKESLERQRSELEDRHQVDMASY
QDAIQQLDNELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECRIGFGPSPF
SLTEGLPKIPSMSTHIKVKSEEKIKVVEKSEKETVIVEEQTEEIQVTEEVTEEEDKEAQG
EEEEEAEEGGEEAATTSPPAEEAASPEKETKSPVKEEAKSPAEAKSPAEAKSPAEAKSPA
EVKSPAVAKSPAEVKSPAEVKSPAEAKSPAEAKSPAEVKSPATVKSPGEAKSPAEAKSPA
EVKSPVEAKSPAEAKSPASVKSPGEAKSPAEAKSPAEVKSPATVKSPVEAKSPAEVKSPV
TVKSPAEAKSPVEVKSPASVKSPSEAKSPAGAKSPAEAKSPVVAKSPAEAKSPAEAKPPA
EAKSPAEAKSPAEAKSPAEAKSPAEAKSPVEVKSPEKAKSPVKEGAKSLAEAKSPEKAKS
PVKEEIKPPAEVKSPEKAKSPMKEEAKSPEKAKTLDVKSPEAKTPAKEEAKRPADIRSPE
QVKSPAKEEAKSPEKEETRTEKVAPKKEEVKSPVEEVKAKEPPKKVEEEKTPATPKTEVK
ESKKDEAPKEAQKPKAEEKEPLTEKPKDSPGEAKKEEAKEKKAAAPEEETPAKLGVKEEA
KPKEKAEDAKAKEPSKPSEKEKPKKEEVPAAPEKKDTKEEKTTESKKPEEKPKMEAKAKE
EDKGLPQEPSKPKTEKAEKSSSTDQKDSQPSEKAPEDKAAKGDK
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgatgagcttcggcggcgccgatgcgctgctgggcgccccgttcgcgccgctgcacgga
ggaggcagcctgcactacgcgctgagccgcaaggcaggcgccggcggcacccgctccgcg
gccggctcctccagcggcttccattcgtgggcgcggacgtcggtgagctccgtgtccgcc
tcgcccagccgcttccgcggcgccggcgccgcctcgagcaccgactcgctagacacccta
agcaatggcccagagggctgcgtggtggcggcggtggctgcgcgcagcgagaaggagcag
ctgcaggcgctcaacgaccgcttcgcgggctacatcgataaggtgaggcagcttgaggcg
cacaaccgcagcctggaaggcgaggcggcggcgctgcggcagcagcaagccggccgcgcc
gccatgggcgagctgtacgagcgcgaggtgcgcgagatgcgcggggccgtgctgcgcctg
ggggcggcgcgcgggcagctgcgcctggagcaggagcacttgctggaggacatcgcgcac
gtccgccagcggctggacgaggaggcccggcagcgcgaggaagcggaggcggcggcccgc
gccctagcccgcttcgcgcaggaggcggaagcggcgcgcgtggagctgcagaagaaggcg
caggcgctgcaggaagagtgcggctacctgcggcgccaccaccaggaggaggtgggcgag
ctgctcggtcagattcagggctgcggtgccgcgcaggcgcaggctcaggccgaggctcgg
gacgccctcaagtgcgacgtgacgtcggcgctgcgggagatccgcgcgcagctcgaagga
cacacggtgcagagtacgctgcagtcagaggagtggttccgagtgagattggaccgactc
tcagaggcagccaaagtgaacacggatgctatgcgctctgcccaagaggagataactgag
taccggcggcagctgcaggccaggaccacagagttggaggcactgaaaagcaccaaggag
tcactggagaggcagcgctctgagctggaggaccgtcatcaggtagacatggcctcctac
caggatgcaattcagcagctggacaatgagctgagaaacaccaaatgggagatggccgcg
cagctccgagagtaccaggacctgctcaacgtcaagatggccctggatattgagatcgct
gcttacagaaaactcctggaaggcgaagagtgtcggattggctttggacccagtcccttc
tctcttactgagggactcccaaaaattccctccatgtccactcacataaaagtcaaaagc
gaagagaagataaaagtagtagaaaaatcggagaaggaaaccgtcattgtagaggaacag
acagaagagatccaggtgacagaagaagtgacagaagaggaggacaaagaggcccaaggg
gaggaagaagaagaggcagaagagggaggagaagaagcagcaactacgtctccccctgca
gaagaggctgcatctccagaaaaggaaaccaagtctcctgtgaaagaagaggccaagtcc
ccagctgaggccaagtccccagctgaggccaagtcaccagctgaggccaagtccccagct
gaggtcaaatctccagctgtggccaagtccccagctgaagtcaaatctccagctgaggtc
aaatctccagctgaggccaagtcaccagctgaggccaagtcaccagctgaggtcaaatct
ccagctacagtgaagtctccaggtgaggccaagtccccagctgaggccaagtcaccagct
gaggtcaaatctccagtggaggccaagtcaccagctgaggccaagtctccagcttcagtg
aagtccccaggtgaggccaagtcaccagctgaggccaagtcaccagctgaggtcaaatct
ccagctacagtgaagtccccagttgaggccaagtcaccagctgaggtcaaatctccagtt
acagtgaagtccccagctgaggccaagtcaccagttgaggtcaaatctccagcttcggtg
aagtccccaagtgaagccaagtcaccagctggagccaagtcaccagctgaggccaagtca
ccagttgtggccaaatcaccagctgaggccaagtcaccagctgaggccaagcctccagct
gaggccaagtcaccagctgaggccaagtctccagctgaggccaagtctccagctgaggcc
aagtcaccagctgaggccaagtcacctgttgaggtaaaatctccagagaaggccaagagc
cccgtgaaggaaggtgcaaaatccctagctgaggccaagtcccctgagaaggccaagtcc
cctgtgaaggaagagatcaagcctccagctgaggtgaaatcccccgagaaggccaagagc
cccatgaaggaggaggccaagtctcctgagaaggccaagactctggatgtgaagtctcca
gaagccaagactccagcgaaggaggaagcaaagcgccccgcagacatcagatcccctgag
caggtcaaaagtcctgccaaggaggaggccaagtcccccgagaaggaagagaccaggact
gaaaaggtggctcccaagaaggaagaggtgaagtcccctgtggaggaggtaaaagccaaa
gaacccccaaagaaggtggaggaggagaagacaccagccacaccaaagacagaggtgaag
gagagcaagaaagatgaagctcccaaggaggcccagaagcccaaggcggaggagaaggag
cctctcacagaaaagcccaaggactctccgggggaagccaagaaggaagaggctaaagag
aagaaggcggcggccccagaggaggagacgcccgccaagttgggcgtgaaggaagaggct
aaacccaaagagaaggcagaagacgccaaggccaaagaacctagcaaaccctcagagaag
gagaaaccgaagaaggaggaggtgccggcagcaccagagaagaaagacaccaaggaggag
aagactacggagtccaagaagcctgaggagaaacccaaaatggaggccaaggccaaggag
gaggacaagggccttccccaagagcctagcaaacccaagacagaaaaggctgaaaagtcc
tctagcacagaccaaaaagacagccagccctcagagaaggccccagaggacaaggctgcc
aagggagacaagtaa

DBGET integrated database retrieval system