KEGG   Rattus norvegicus (rat): 24588Help
Entry
24588             CDS       T01003                                 

Gene name
Nefm, Nef3, Nfm
Definition
(RefSeq) neurofilament, medium polypeptide
  KO
K04573  neurofilament medium polypeptide (neurofilament 3)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    24588 (Nefm)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    24588 (Nefm)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type IV
     24588 (Nefm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Filament_head DUF1664
Motif
Other DBs
NCBI-GeneID: 24588
NCBI-ProteinID: NP_058725
RGD: 3160
UniProt: P12839
Position
15p12
AA seq 845 aa AA seqDB search
MSYTLDSLGNPSAYRRVTETPSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSALAPR
LAYSSAMLSSAESSLDFSQSSSLLNGGSGGDYKLSRSNEKEQLQGLNDRFAGYIEKVHYL
EQQNKEIEAEIHALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDI
HRLKERFEEEARLRDDTEAAIRALRKDIEESSMVKVELDKKVQSLQDEVAFLRSNHEEEV
ADLLAQIQASHITVERKDYLKTDISTALKEIRSQLECHSDQNMHQAEEWFKCRYAKLTEA
AEQNKEAIRSAKEEIAEYRRQLQSKSIELESVRGTKESLERQLSDIEERHNHDLSSYQDT
IQQLENELRGTKWEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTFSGSITGP
LYTHRQPSVTISSKIQKTKVEAPKLKVQHKFVEEIIEETKVEDEKSEMEDALTVIAEELA
ASAKEEKEEAEEKEEEPEVEKSPVKSPEAKEEEEGEKEEEEEGQEEEEEEDEGVKSDQAE
EGGSEKEGSSEKDEGEQEEEGETEAEGEGEEAEAKEEKKTEGKVEEMAIKEEIKVEKPEK
AKSPVPKSPVEEVKPKPEAKAGKDEQKEEEKVEEKKEVAKESPKEEKVEKKEEKPKDVPD
KKKAESPVKEKAVEEMITITKSVKVSLEKDTKEEKPQQQEKVKEKAEEEGGSEEEVGDKS
PQESKKEDIAINGEVEGKEEEEQETQEKGSGQEEEKGVVTNGLDVSPAEEKKGEDRSDDK
VVVTKKVEKITSEGGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKE
VTQGD
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgagctacacgctggactcgctgggcaacccgtccgcctaccggcgcgtcaccgagacc
ccgtccagcttcagtcgtgtgagcggttccccgtccagcggcttccgctcgcagtcctgg
tcccgcggctcgcccagcaccgtgtcctcctcctacaagcgcagcgcgctcgccccgcgc
ctcgcctacagctcggctatgctcagctcggccgagagcagcctcgacttcagccagtcc
tcttcgctgcttaacggcggctccggcggcgactacaagctgtcccgctcaaacgagaaa
gagcagctgcaggggctgaacgaccgtttcgccggctacatcgagaaagtgcactacttg
gaacaacagaacaaggagatcgaggcagagatccacgcgctgcggcagaagcaggcctcg
cacgcccagctgggtgacgcttacgaccaggagatccgagagctgcgcgccaccctggag
atggtgaatcacgagaaggctcaagtgcagctggactctgatcacttggaggaagacatc
caccggctcaaggagcgcttcgaggaggaggcgcggctgcgggacgacaccgaggctgcc
atccgggcgctgcgcaaagacatagaggagtcgtcgatggttaaggtggagctggacaag
aaggtgcagtcgctgcaggatgaggtggccttcctgcggagcaatcacgaagaggaggtg
gccgacctgctggcccagatccaggcgtcgcacatcaccgtagagcgcaaagactacctg
aagacagacatctccacggcgctgaaagagatccgctcccagctcgagtgtcactccgac
cagaacatgcaccaggccgaagagtggttcaaatgccgctacgccaagctcaccgaggcg
gccgagcagaacaaggaggccatccgctccgctaaagaagagatcgccgagtaccggcgc
cagctgcagtccaagagcattgagctcgagtcggtgcgaggcactaaggagtccctggaa
cggcagctcagcgacatcgaggagcgccacaaccacgacctcagcagctaccaggacacc
atccagcagctggaaaatgagcttcggggaacaaagtgggaaatggctcgtcatttgcga
gaataccaggatctccttaacgtcaagatggctctggacatcgagatcgccgcatatagg
aaactactggagggtgaagagaccagatttagcacattttcaggaagcatcactgggcct
ctgtacacacaccgacagccctcagtcacaatatccagtaagattcagaagaccaaagtc
gaggcccccaagctcaaggtccaacacaaatttgtggaggagatcattgaggagactaaa
gtggaagatgagaagtcagaaatggaagacgccctcacagtcattgcagaggaattggca
gcctctgccaaagaggagaaagaagaggcagaagaaaaggaagaggaaccggaagttgaa
aagtctcccgtgaagtctcctgaggctaaggaagaggaggaaggggaaaaggaggaagaa
gaggaaggccaagaggaagaagaggaggaagatgaaggtgtcaagtcagaccaggcagaa
gagggaggatctgagaaggaaggctcgagtgaaaaggatgaaggtgagcaagaagaagaa
ggggaaactgaggcagaaggtgaaggagaggaagcagaagctaaggaggaaaagaaaaca
gagggaaaggtcgaggaaatggctatcaaggaggaaatcaaggtcgagaagcccgagaaa
gccaagtcccctgtgccaaaatcacccgtggaagaagtaaagccaaaaccagaagccaaa
gccggaaaggatgagcagaaggaggaagagaaagttgaggagaagaaggaggtagccaag
gaatcacccaaggaagagaaggtggagaaaaaggaggagaagccaaaagatgtcccagat
aaaaagaaggctgagtccccagtgaaagaaaaggccgtagaggaaatgatcaccattact
aagtcggtaaaggtgagcctggagaaagacaccaaagaggagaagcctcagcagcaggag
aaggtgaaggagaaggcagaggaggaggggggtagtgaggaggaagtgggtgacaaaagc
ccgcaagaatccaagaaggaagacatagctatcaatggggaggtggaaggaaaagaggag
gaggagcaggaaactcaggagaagggcagtgggcaagaggaggagaaaggggtggtcact
aatggcttagatgtgagccctgcggaggaaaagaaaggggaggatagaagtgatgacaaa
gtggtggtgaccaagaaggtagaaaaaatcaccagcgagggaggcgatggtgctaccaaa
tacatcaccaaatctgttactgtcactcaaaaggttgaagagcatgaggagacctttgag
gagaagctggtgtcaactaaaaaggtagaaaaggtcacttcacatgccatagtcaaggaa
gtcacccagggtgactaa

DBGET integrated database retrieval system