KEGG   Rattus norvegicus (rat): 24590Help
Entry
24590             CDS       T01003                                 

Gene name
Mme, CD10, Nep, SFE
Definition
(RefSeq) membrane metallo-endopeptidase
  KO
K01389  neprilysin [EC:3.4.24.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04614  Renin-angiotensin system
rno04640  Hematopoietic cell lineage
rno04974  Protein digestion and absorption
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24590 (Mme)
  09152 Endocrine system
   04614 Renin-angiotensin system
    24590 (Mme)
  09154 Digestive system
   04974 Protein digestion and absorption
    24590 (Mme)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24590 (Mme)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24590 (Mme)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24590 (Mme)
   04090 CD molecules [BR:rno04090]
    24590 (Mme)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.11  neprilysin
     24590 (Mme)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M13: neprilysin family
   24590 (Mme)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24590 (Mme)
CD molecules [BR:rno04090]
 Proteins
  24590 (Mme)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M13_N Peptidase_M13 CRAL_TRIO_2
Motif
Other DBs
NCBI-GeneID: 24590
NCBI-ProteinID: NP_036740
RGD: 3098
Ensembl: ENSRNOG00000009514
UniProt: P07861
Position
2q31
AA seq 750 aa AA seqDB search
MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDASAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLTLLPDIYGWPVASQNWEQTYGT
SWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEQRLPIDENQLSLEMNKVMELEKEIANATTKPEDRNDPMLLY
NKMTLAKLQNNFSLEINGKPFSWSNFTNEIMSTVNINIQNEEEVVVYAPEYLTKLKPILT
KYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIISNENKLNNEYLELNYKEEEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSARQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKDQSQCMVYQYGNFTWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFADAFHCRKNSYMNPERKCRVW
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgggaagatcagaaagtcagatggatattactgatatcaatgctccaaagccgaagaag
aaacagcgatggactccactggagatcagcctttctgtgctcgtcttgctcctgactatc
atagctgtgacaatgattgctctctatgcaacctatgatgatggtatttgcaaatcatca
gactgcataaaatcagctgctcgactgatccagaacatggatgcctctgctgagccatgt
acggacttcttcaaatatgcttgtggaggctggttgaaacgcaatgtcatccctgagacc
agttcccgatacagtaattttgacattctaagagatgaactagaagtcattttgaaagat
gtccttcaagaacccaaaactgaggacatagtagcagtgcagaaagcaaaaactttgtac
agatcatgtataaatgaatctgctattgatagcagaggtgggcaacctctgctcacactg
ttaccagatatatatgggtggccagtagcatcacaaaactgggaacaaacatatggtact
tcttggacagctgagaaatctattgcacaactgaattctaaatatgggaaaaaggtcctc
attaatttttttgttggcactgatgataagaattctacccagcatataattcattttgac
cagcctcgacttggcctcccttccagagactactatgagtgtacaggaatatataaagag
gcttgcacagcatatgtggattttatgatttctgtggccagactgattcgtcaggaacaa
agattgcctattgatgaaaaccagctctctttggaaatgaataaagttatggaattggaa
aaagaaattgccaatgccacaactaaaccagaagaccgaaatgacccaatgctgctttat
aacaaaatgacattggccaagctccaaaataacttctctctggagatcaatgggaagcca
ttcagctggtcaaatttcacaaatgaaatcatgtcaactgtgaatattaatattcaaaat
gaggaagaagtggttgtttatgctccagaatatttaaccaaacttaagcctattcttacc
aaatattctcccagagatcttcaaaatttaatgtcctggaggttcataatggatcttgta
agcagcctcagccgaaactacaaggagtccagaaatgctttccgcaaggccctttacggg
actacatccgaaactgcaacctggagacggtgtgccaactacgtcaatgggaacatggag
aatgctgtggggaggctttatgtggaagcagcttttgctggagagagcaagcacgtggtt
gaagatttgattgcacaaatccgtgaagtttttattcagactttagatgacctcacttgg
atggatgctgagacaaaaaagaaagctgaagagaaggccctggcaattaaagaaaggatt
ggctatcctgatgacatcatctccaatgagaataaactgaataatgagtatcttgagttg
aactacaaggaagaggaatactttgagaacataattcaaaatttgaaattcagccaaagc
aagcagctaaagaagctccgagaaaaggtggacaaagatgagtggataagtggcgcggcg
gtagtcaatgcattttattcctcaggcagaaatcagatcgtcttccccgccggcattttg
cagcccccattctttagtgctcggcagtccaactcattgaactatgggggcatcggcatg
gtcatcggacatgaaatcacacatggctttgatgacaatggcagaaattttaacaaagat
ggagacctcgttgactggtggactcagcagtctgcaaataatttcaaagaccaatcccag
tgtatggtgtaccagtatggaaactttacatgggacctagcaggtggacagcatctcaat
ggaattaacacactaggagaaaatattgctgataatggagggattggccaagcatacaga
gcctatcagaattatgttaaaaagaatggtgaagaaaaattactccctggacttgacctc
aatcacaaacaactattcttcttgaactttgcccaggtgtggtgtggaacctaccggcca
gagtatgcagtcaattccattaaaacagatgtacacagtcctggcaatttcaggatcatt
gggactttgcagaactctgctgagtttgcggatgcctttcattgccgcaagaactcatac
atgaatccagaaaggaaatgtcgggtttggtga

DBGET integrated database retrieval system