KEGG   Rattus norvegicus (rat): 24591
Entry
24591             CDS       T01003                                 

Gene name
Neu1
Definition
(RefSeq) sialidase-1 precursor
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    24591 (Neu1)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    24591 (Neu1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    24591 (Neu1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     24591 (Neu1)
SSDB
Motif
Pfam: BNR_2 BNR_3 BNR
Other DBs
NCBI-GeneID: 24591
NCBI-ProteinID: NP_113710
RGD: 3163
Ensembl: ENSRNOG00000032942
Vega: OTTRNOG00000001721
UniProt: Q6MG70
Position
20
AA seq 409 aa
MVGAEPSRPPGPPSYWTGRRGQGLAAIFLLLVSAAGSEARTEDDFSLVQPLVTMEQLLWV
SGKQIGSVDTFRIPLITATPRGTLLAFAEARKKSASDEGAKFIAMRRSTDQGSTWSSTAF
IVDDGEASDGLNLGAVVNDVDTGVVFLIYTLCAHKVNCQVASTMLVWSKDDGVSWSPPRN
LSVDIGTEMFAPGPGSGIQKQREPWKGRLIVCGHGTLERDGVFCLLSDDHGASWHYGTGV
SGIPFGQPKHDHDFNPDECQPYELPDGSVIINARNQNNYHCRCRIVLRSYDACDTLRPRD
VTFDPELVDPVVAAGALATSSGIVFFSNPAHPEYRVNLTLRWSFSNGTSWQKERVQLWPG
PSGYSSLTALENSTDGKKQPPQLFVLYEKGLNRYTESISMVKISVYGTL
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggtgggggcagagccaagcagacccccgggaccaccgagctactggacaggccggcgg
ggtcaggggctcgcagcgatcttcctgctcctggtgtccgcggcgggatcagaggccagg
acagaggatgacttcagcctggtgcagccgctggtgaccatggagcaattgctgtgggtg
agcgggaagcagatcggctccgtagacacttttcgaatcccgctcatcacagccacccct
cggggcacgctcctggccttcgctgaggctaggaaaaagtctgcatccgatgagggggcc
aagttcatcgctatgaggaggtccacagaccagggtagcacgtggtcctctacggctttc
attgtagacgacggggaggcctccgatgggctgaacctgggggctgtggtgaacgacgta
gacacaggagtggtgttcctcatctataccctctgtgctcacaaggtcaactgccaggtg
gcctctaccatgctggtttggagtaaggatgacggcgtttcctggagcccaccgcggaat
ctctccgtggatattggcacagagatgtttgcccctggacccggctctggcattcagaaa
cagcgggagccttggaagggccggctcattgtgtgtggacacgggacgctggagcgagat
ggggtcttctgtctcctcagtgatgaccacggtgcctcctggcactatgggactggagtg
agcggcattcccttcggccagcccaaacacgatcacgatttcaaccccgacgagtgccag
ccctacgagcttccagacggctcagtcatcatcaacgcccggaaccagaataactaccac
tgccgctgcaggatcgtcctccgcagctatgacgcctgtgacaccctcaggccccgggat
gtgaccttcgaccctgagctcgtggaccctgtggtagctgcaggagcgctagccaccagc
tccggcattgtcttcttctccaatccagcccatcccgagtaccgagtgaacctgaccctg
cgctggagcttcagcaatggcacatcctggcagaaggagagggtccagttgtggccggga
cccagcggctactcatccctgacagccctggaaaacagcacggacgggaagaagcagccc
ccgcagctgttcgttctgtacgagaaaggactgaaccggtacacggagagcatctccatg
gtcaaaatcagcgtctacggcacgctctga

DBGET integrated database retrieval system