KEGG   Rattus norvegicus (rat): 245919Help
Entry
245919            CDS       T01003                                 

Gene name
Impg2, Pg10.2
Definition
(RefSeq) interphotoreceptor matrix proteoglycan 2
  KO
K19017  interphotoreceptor matrix proteoglycan 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    245919 (Impg2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   245919 (Impg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SEA EGF DUF4214
Motif
Other DBs
NCBI-GeneID: 245919
NCBI-ProteinID: NP_620788
RGD: 708358
Ensembl: ENSRNOG00000001622
UniProt: F1LNC8
Position
11q12
AA seq 1241 aa AA seqDB search
MIMFLPLGRISLGILILFLTGGNLVSVSEEIQDRMHAVAVLSPKESTDLSLPTRKRQLLD
ATETGRRWPLRRRRSILFPNGVRICPSDTVAEAVANHVKYFKARVCQEAIWEAFRTFWDR
LPGREEYQYWMNLCEDGVTSVFEMGTQFSQSVEHRHLIMEKLTYTKEAESSSCKDQACGP
ELSSPVPIGETSTLAGAVSSASYPGAASERSAASPQESISNEIENVTEQPTPPAAEQIAE
FSIQLLGKQYSEELRDPSSALYRLLVEEFISEVEKAFTGLPGYKGIHVLDFRSPKENGSG
IDVHYAVTFNGEAISNTTWDLISLHSNKVENHGLVELDDKPTAVYTISNFRDYIAETLHQ
NFLMGNSSLNPDPKSLQLINVRGVLLPQTEEIVWNTQSSSLQVTTSSILDNTLQAEWLSA
DESITTTTTTTISPFGFSSGPPSATGRELHSESTLGDIVSTPKLASPSKVVLSSSPEVLG
GSSLTLHSVTPAVLQIDLPVAPEGRTSGSSILEDDNTEESEDVSIDVLPSSSLIQPVPKE
TVPPMEDSDMILLTSSPHLTSSVIEDLAKDITTPSGLDSLASRVSDKLEVSPWFPDTSVE
KEFIFESGLGSGSGKNVDVIDWPWSETSLEKTTEPLSKSWSEEQDTLLPTESIEKLHMYF
TEQMIEPSAHRYGDGPIYFTEEESHVRSTIPVFAESATQPTSLISSKHTSDVPDIDSYSV
TKAPFLLATIANTASTKETDEVNTLLKKGMVQTEPSSPKGLDSKISVARPDMQPVWTILP
ESDTVWARTSSLGKLSRDTLVSTPESADRLWLKASMTQPAELPPSTHSIQLEDEVIMAVQ
DISLELDQVGTDYYQPELTQEQNGKVDSYVEMPTHVHYTEMPLVAQPTKGGVLSRTQTAG
ALVVFFSLRVTNMLFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLSGFQNLEILNFRNG
SIVVNSRVKFAESVPPNVNNAIYMILEDFCTTAYQTMNLDIDKYSLDVESGDDANPCKFQ
ACNEFSECLVNPWSGEAKCKCHPGYLSVDELPCQSVCDLQPDFCLNDGKCDVMPGHGAIC
RCRVGSNWWYRGQHCEEFVSEPFVIGITIASVVSLLLVASAVVFFLAKMLQAQNVRRERQ
RPTNRQPDSLSSVENAMKYNPAYESRLAGCEQYEKPYSQHPFYSSASEEVIGGLSREEIR
QMYESSDLSKEEIQERMRILELYANDPEFAAFVREHEMEEL
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgattatgtttctccctttggggaggatttctctgggcattttgatacttttcctgaca
ggaggaaaccttgtatcagtctcagaagagatacaagaccgcatgcatgcagttgctgtc
ctctcacctaaggagtcaacagacctttccctgcctaccaggaagagacagcttttggat
gccacagagactggaaggaggtggccgcttagaaggcgacgatctattctgttcccaaat
ggagtaagaatttgccccagtgacactgttgcagaggctgtggcaaaccatgtgaagtat
tttaaagcccgagtgtgccaggaagccatctgggaagccttcaggacattttgggaccga
cttcctgggcgtgaggaatatcaatactggatgaacttatgtgaggatggagtcacaagt
gtatttgaaatgggcacccagtttagtcaatctgtggaacacagacacttaatcatggag
aaattgacatacacaaaggaagctgagagcagctcctgcaaggatcaggcctgtggacct
gagttgtcatctccagttcctattggcgagacctcaacattggcaggtgctgtctccagt
gcttcctatccaggggcggcctcagagagaagcgcggcatcaccacaggagagtatcagc
aatgaaattgagaatgtgacagagcagcccacaccgccagctgctgaacagatagctgaa
ttcagcatccaacttctggggaagcagtacagcgaagaactgcgggatccctccagcgcc
ctctaccggctccttgtggaagagtttatttcagaggttgaaaaagctttcacagggtta
cctggctacaagggcatccatgttctggatttcaggtctccaaaggaaaatggcagtggg
atagatgttcactatgcagttactttcaacggcgaggccatcagcaataccacctgggac
ctcataagccttcactccaacaaggtggagaaccatggccttgtagagctggatgataaa
cccacggccgtctatacgatcagtaacttcagagattatatcgctgagacactgcaccag
aactttttaatgggaaattcttctttgaatccagatcccaagtctctccagcttatcaat
gtgagaggagttctgctcccccaaacggaagaaatagtttggaacacccaaagttcaagt
cttcaggtgacaacgtcctctattctggataataccctgcaagctgaatggctctcagca
gatgaatccatcaccaccaccaccaccaccactatttcaccatttggtttcagctccggt
cctccctcagccactggcagggaactccattcagaaagtactttgggtgacatagtgtct
acacccaagttagcttctccctcgaaggtggtcctcagttcttccccagaggttttaggg
ggtagcagcttgactcttcattctgttaccccagcagtgcttcagattgacctgcctgtg
gctcctgagggaaggacttctggatcttccatattagaagacgacaacacagaagaatca
gaagatgtttctattgatgtattgccttcaagctcattaattcaacctgtgccaaaagaa
acagtaccacccatggaagactctgacatgattctcctgacatcctcaccacatctgacc
tcttctgttatagaagaccttgctaaagacataacgacaccttctggcttggactccttg
gcttccagagtctcagacaagttggaagtgagcccatggtttccagacacctctgtggaa
aaagagttcatttttgaaagtggcttgggctctgggtctgggaaaaatgtcgatgtgatt
gattggccatggagtgagacttcattagagaagaccactgaacccctgtcaaagtcatgg
tctgaagagcaggatacactattaccaactgagagtatagaaaaattacatatgtatttc
acagaacaaatgattgaaccttcagcacatagatatggagatggacccatatattttaca
gaggaagaatcccatgttagatctaccatacccgtctttgcagagtctgcaactcaacct
acatctctaatttcttcaaagcacacatcagatgtaccagacattgattcttactcagtt
accaaagcacccttcttactggcaactatagcaaacactgcttccaccaaggaaacagat
gaggtgaataccctcctaaaaaaaggtatggtacaaacagaaccatccagtcccaaagga
cttgacagcaagatttcagtagcaaggccagatatgcagcctgtgtggaccattttgcca
gaatcagatacagtttgggcgaggacttcttccttagggaaattgtccagggacacattg
gtgagtacaccagagagcgctgacagactctggttgaaggcctccatgacacagcccgct
gaattgcctccatccacccactccatccagctagaggatgaagttataatggctgtccag
gatatttcattagaactagaccaggtaggcacggattactatcagcctgagctaacccaa
gaacaaaatggcaaggttgatagctatgtggaaatgcctacccatgttcactacacagag
atgcctcttgtagctcagcccacaaaaggcggtgtcttgagtcgcacccagactgcagga
gctttggtggttttcttcagcctccgagtgacaaacatgttgttttcagaagacctgttt
aacaaaaactctttggagtataaagccctggagcaaagattcttagaactgctggttccc
tatctccagtcaaatctgtcagggttccagaacttagagatcctgaacttcagaaatggc
agcattgtggtgaacagcagggtgaagttcgccgagtctgtccctcctaatgtcaacaac
gccatatatatgattctggaagacttttgtaccaccgcctaccaaaccatgaacctggat
attgataagtactccctggatgtggaatcaggtgatgacgccaacccttgcaagtttcag
gcctgtaatgaattttctgaatgtttggtaaatccatggagtggagaagcaaagtgcaaa
tgccaccctgggtacctgagtgtggatgaactgccttgtcaaagtgtctgtgacctacag
cctgacttctgcttgaatgatggaaagtgtgacgttatgcctggacatggagccatttgt
agatgccgggttggttcaaattggtggtatcgaggccaacactgtgaggagtttgtgtct
gagccctttgtcataggcatcacgatagcctcagtggttagccttctccttgttgcttct
gctgtcgttttcttccttgcgaagatgcttcaagctcagaatgtcaggagagaaaggcag
cggcctaccaacaggcagcctgacagcctgtcatctgttgagaatgctatgaagtacaac
cctgcatacgagagccgcttggctggatgtgaacagtatgagaaaccctatagccaacac
cctttctatagctctgctagtgaagaggtgattggtggtctgagcagagaagaaatcaga
cagatgtatgaaagcagcgacctttccaaagaggaaattcaagagagaatgaggattttg
gaactctatgctaatgatcccgagtttgcagctttcgtgagagagcatgagatggaggag
ctttaa

DBGET integrated database retrieval system