KEGG   Rattus norvegicus (rat): 245920
Entry
245920            CDS       T01003                                 

Gene name
Cxcl10
Definition
(RefSeq) C-X-C motif chemokine 10 precursor
  KO
K12671  C-X-C motif chemokine 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05160  Hepatitis C
rno05164  Influenza A
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    245920 (Cxcl10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    245920 (Cxcl10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    245920 (Cxcl10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    245920 (Cxcl10)
   04622 RIG-I-like receptor signaling pathway
    245920 (Cxcl10)
   04623 Cytosolic DNA-sensing pathway
    245920 (Cxcl10)
   04657 IL-17 signaling pathway
    245920 (Cxcl10)
   04062 Chemokine signaling pathway
    245920 (Cxcl10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    245920 (Cxcl10)
   05171 Coronavirus disease - COVID-19
    245920 (Cxcl10)
   05164 Influenza A
    245920 (Cxcl10)
   05169 Epstein-Barr virus infection
    245920 (Cxcl10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    245920 (Cxcl10)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    245920 (Cxcl10)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   245920 (Cxcl10)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   245920 (Cxcl10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 245920
NCBI-ProteinID: NP_620789
RGD: 620209
Ensembl: ENSRNOG00000022256
UniProt: P48973
Position
14
AA seq 98 aa
MNPSAAVVLCLVLLSLSGTQGIPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHV
EIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaacccaagtgctgctgtcgttctctgcctcgtgctgctgagtctgagtgggactcaa
gggatccctctcgcaagaacggtgcgctgcacctgcatcgacttccatgaacagccgctg
agacccagggccataggaaaacttgaaatcattcctgcaagtctatcctgtccgcatgtt
gagatcattgccacaatgaaaaagaacaatgagaagaggtgtctgaatccggaatctgag
gccatcaagagcttattgaaagcggtgagccaaagaaggtctaaaagagctccgtaa

DBGET integrated database retrieval system