KEGG   Rattus norvegicus (rat): 245921Help
Entry
245921            CDS       T01003                                 

Gene name
Acvr1c, Alk-7, Alk7, habrec1
Definition
(RefSeq) activin A receptor type 1C
  KO
K13568  activin receptor type-1C [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    245921 (Acvr1c)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    245921 (Acvr1c)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    245921 (Acvr1c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    245921 (Acvr1c)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     245921 (Acvr1c)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   245921 (Acvr1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 245921
NCBI-ProteinID: NP_620790
RGD: 621789
Ensembl: ENSRNOG00000004828
UniProt: P70539
Position
3q21
AA seq 493 aa AA seqDB search
MTPASRSALSLALLLVALASDLAAGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVI
KSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPDAPRLGPTELTVVITV
PVCLLSIAAMLTIWACQDRQCTYRKTKRHNVEEPLAEYSLVNAGKTLKDLIYDATASGSG
SGLPLLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQ
TVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMVKLALSIA
SGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCDTCAIADLGLAVKHDSIMNTIDIPQN
PKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGLVEEYQLPYYD
MVPSDPSIEEMRKVVCDQKLRPNLPNQWQSCEALRVMGRIMRECWYANGAARLTALRVKK
TISQLCVKEDCKA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagcaagccgctccgcactgagcctggccctcctgctggtggcactggcctcc
gaccttgcggcaggactgaagtgtgtgtgtcttttgtgtgattcctcaaactttacctgc
caaaccgaaggagcatgctgggcctctgtcatgctaaccaacgggaaagaacaggtgatc
aaatcgtgcgtgtccctcccggaactaaatgctcaggtcttctgtcacagttccaacaac
gtgaccaagaccgaatgttgcttcacagacttctgcaacaacatcactctgcaccttccc
acagcatctccagatgcccctagacttggccccacagagctgacagttgttatcactgta
cctgtttgcctcctgtccatcgcagccatgctaacgatatgggcctgccaggaccgccag
tgcacatacaggaagaccaagagacacaatgtggaggaaccactggcagagtacagcctt
gtcaatgctggaaaaaccctcaaagatctgatttatgatgccactgcctcgggctcagga
tctggcctgcctcttttggttcaaagaaccatcgcaaggacaattgtacttcaagaaatc
gtaggaaaaggtcggtttggggaagtgtggcacggaagatggtgtggagaagatgtggct
gtgaaaatattctcctccagagatgagagatcttggttccgtgaggcagaaatttatcag
acggtaatgctgagacatgagaatattctcggtttcatcgcggccgacaacaaagataat
ggaacctggactcagctttggcttgtgtcagagtatcacgagcagggctccttatatgac
tatttgaatagaaacatagtgaccgtggctggaatggtcaagttggcgctttcaatagcg
agtggtctggctcacctacacatggagatcgtgggcactcaaggtaagcctgctattgct
caccgagatataaagtcaaagaatatcttagtcaaaaagtgtgacacttgtgccatagct
gacttagggctggctgtgaaacatgattctatcatgaacactatagatataccccagaat
cctaaagtgggaaccaagaggtatatggctcccgaaatgcttgatgatacaatgaacgtc
aacatctttgagtccttcaagcgagctgacatctattcggtggggctggtttactgggaa
atagctcgaaggtgttcagttggaggacttgttgaagagtaccagttgccttattatgac
atggtgccttcagatccttccatagaggaaatgaggaaggtcgtttgtgatcagaaactc
cgaccaaatctcccaaaccagtggcaaagctgtgaggcgctccgggtcatgggaagaata
atgcgtgagtgctggtatgccaacggggcagctcgcctgaccgccctgcgcgtgaagaag
accatttctcagctgtgtgtcaaggaagactgtaaggcctaa

DBGET integrated database retrieval system