KEGG   Rattus norvegicus (rat): 245925
Entry
245925            CDS       T01003                                 

Gene name
Phrf1
Definition
(RefSeq) PHD and ring finger domains 1
  KO
K17586  PHD and RING finger domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    245925 (Phrf1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     245925 (Phrf1)
SSDB
Other DBs
NCBI-GeneID: 245925
NCBI-ProteinID: NP_620793
RGD: 708360
Ensembl: ENSRNOG00000017299
UniProt: Q63625
Position
1q41
AA seq 1473 aa
MRRLKRKTRPFVKCVAGVIVRTGSYFVTAVMLDAAPVSDEEVSLLLADVVPTTSRLRPRV
GRTRAIARTRQSERVRATVNRNRISSARRVQHVPRYLMSSLLDETIEAVATGLSTAVYQR
PLTPRVPAKRKRKAGRRKKVLGRKKTRSRSSVKSKSGGTRAKKRQHRVRRTKGRKLKNEV
TARSRIARTLGLRRPVRGTSMPSVYKPVDPSLGLMRADIGAASLSLFGDPYALDPFDSNG
EQSADPPSPLSAKRRVLSRSALQSHQPVARPVAMGLARRQLPAVAPEPSVEEAPVPDLLG
SILCGQSLLMMSSADVVIHRDGSLSAKRAAPVSLQRNSVTQSREESRLRDNLQPGALPSE
SVSGGLIGDRRPNSGLSCGDRTALRCLPAQIVQTPVRSDSSVSPRSGLSGNLSDESRPKW
KHSNSPRLNGSNVRVGSASTKTMTHSNFPSKNIAPGHPQKTDPRRPDFSKLPRIPKIRRD
GSNSTQDQAPASGQTVELPSACISRLTGREGPGQPGRGRADSEPSSRGPQETGSHTSGSR
PPAPSSHGNLAPLGPSRGKGIGSSFESFRINIPGNTAHCSPLSSPGFCNTFRPVDSKVQR
KENPSPLFSIKKPKQLKSEIYDPFDPTGSDSSPPSSSPESLGPDLLPSEITRTISINSPK
APAFQTVRCVTSYRVESVFGTEMDPDPQPPGEPVSGMLELLGKGPAEGASDLEQEGLGEI
EPTEIQGSSARAQRPSPPDPWDDEDGVSCTPFFGSEERTVTCVTVEEPSVPSPDAPQITT
HRIVEFRASSRSRSTSSSRSRKKTKKKKKVAREHQRTRSSTRSGSRDRTSRSVSPFTEEH
TKRHRAKTKSRRSSSDRASSQDRAKRRKDRDREHRRGPWGHGRCWRKSRSRSGSPGSSSC
ERHESRRRKRRHSGSRSRGRDGSPHSSLERDRRHKHRERSRERMDKKESMTRSRERRRWR
SRSPSVEHRTRRPHSREKHPHSPEKKGAVREVSPAPAPQGEPRQDGDHSTKPPVSEVSVL
PEVVSVLPEVVVADLNPPEVPPVLAESVSCVPEDLDYGDSVEAGHVFEDFSNEAIFIQLD
DMSSPPSPESTDSSPERDFLPNPILPPASLPQNSTLPVTQREVLPIHSEDISKPAPQPLA
PSDQCLLRQDTVETTATTLSTPGVLPMGKDSPLLSGRGCEVVRPKDAVAPAPLLRSRTLV
KRVTWNLQEAEASTPALDRDPRTPLQRPQRPQEGDWDAEDRALIGFQQAPFSELPPPIHV
LQESGLPDADPSQPPGVPRAEGPPAVGTLHSAGGILAQVYSPNMPPPLAQPSSIPPYALV
NQPSVQLILQGTLPLAGCGAAQNLAPVPTMPATASELAVPTTNNSEERTATPKTAAEKTT
KEEYMKKLHMQERAVEEVKLAIKPFYQKREVTKEEYKDILRKAVQKICHSKSGEINPVKV
ANLVKAYVDKYRHMRKHKKTEAGEEPPTQGAET
NT seq 4422 nt   +upstreamnt  +downstreamnt
atgaggaggctgaagaggaagacccgaccttttgtgaagtgtgtggcaggagtgatcgtg
aggaccggctcctactttgtgacggctgtgatgctggatgcagctcctgtgagtgatgag
gaggtctccttgctactggctgatgtagtgccaaccaccagcagacttcggcctcgagta
ggcaggacccgggccatcgctaggacacggcagagtgagagagtgagggcaactgtgaac
cggaaccggatctcttctgccagaagggtccagcatgtgccacggtacctcatgtcttct
ctgctggatgaaactattgaggctgtcgccactggtctgagcacagctgtataccagcgt
cccttgacacctcgtgttcctgcaaaacggaaaaggaaggcagggagacgaaagaaagta
ctgggaaggaagaaaacccggtccaggtcatctgtgaaaagtaagagtgggggtacaaga
gccaagaaacggcagcaccgtgtgaggaggacgaaagggaggaagctgaagaacgaagtc
acagctcgttctcgcattgcacgaacactaggcctccgcaggcctgtccgtggcaccagc
atgccatcagtatacaagcctgtggacccctctcttgggctgatgagggcagatattgga
gcagcttctctgtcactgtttggagatccctatgcactagacccttttgacagcaatgga
gaacagtctgcagatccgccttcccctctgagtgccaagaggagagtgctgtcccgctca
gccctgcagtctcaccagcctgtggccagacctgtcgccatgggactcgctaggaggcag
ctccctgctgtggccccagagcccagtgtggaggaggcccccgtccctgacctgctgggg
agcatcctgtgtggccagagcctcctgatgatgagcagtgctgatgttgtcatacaccgg
gatggctctctcagcgccaagagggcagctcctgtttctcttcagcgaaattctgtgact
caatccagagaagagtccaggctcagagacaacctgcagcctggggcactaccttcagag
agcgtatccggtggactcataggagacagacgaccaaactcagggctgagctgtggggac
agaacagctctgcgctgtctccctgcccaaatagtgcagacacctgtgaggtcagattca
tcagtttcccctcgttcaggtctgtctgggaacctttcagatgagagcagacctaaatgg
aaacacagtaacagcccccgactcaatggctccaatgtacgggttggttctgcttcaact
aagaccatgactcattctaactttccatctaaaaatatagctcctgggcatcctcagaaa
acagatcccaggagacctgatttctccaagctccccaggataccaaagatccgcagggat
ggcagtaatagcacacaggaccaggccccagccagcggtcagactgtcgagctccccagc
gcatgcatcagccgcctgactggcagggaaggccctgggcagccaggacgaggccgggct
gacagtgagcccagcagcaggggtccccaggagactggctcacacacaagtggttctcga
cctcctgcgcccagctcccatggcaacctagctcctctagggccctcaagaggaaagggc
attgggtctagctttgaaagcttcaggatcaacatccctgggaacactgcgcactgcagc
ccgctgtccagccctggattctgtaacacattccggccagtagacagcaaggtacagagg
aaggagaacccttcacccctcttctccatcaagaagccgaaacaactcaaaagtgaaatc
tatgacccctttgatcccactggctcagactctagccctcctagcagcagcccagagagt
cttggtccagaccttctgccctctgagatcacaagaactatctccatcaatagcccaaag
gccccagccttccagactgtgcgctgtgttacctcctacagagtagaaagcgtctttggg
actgagatggaccctgatccccagccccctggggagcctgtctctggcatgctggagtta
cttggcaagggacctgctgagggagcctctgatttggagcaagaaggactaggtgaaata
gagcctacagaaattcagggctcctcagcccgagcacagaggccatccccaccagaccct
tgggatgatgaggatggagtgtcctgtacgcccttctttggctctgaggagcggacagtg
acatgtgtgactgtcgaggagccaagtgttccaagcccagatgctccacagataaccacc
cacagaattgtggagttcagagcctcatcccgttcccgctccacctccagctcccgaagc
aggaagaaaacaaagaagaagaagaaggttgccagagagcaccagaggacacgatccagc
actcgctcaggctccagggacaggacttcacgctcagtatctccatttaccgaggaacac
accaagagacacagagccaagactaagagccggaggtcttccagtgaccgtgccagcagc
caggacagagcaaagaggaggaaggacagagacagggagcatagacggggtccctggggt
catggcagatgctggaggaagtccaggtcccgctcagggagtcctggcagttcctcctgt
gagcgccatgagagtaggagacggaagaggcggcattcagggtccagatctcgtggcagg
gatggctcaccacacagcagcctggagagggaccggagacataaacatcgggagaggagc
cgagagcggatggacaagaaggagagtatgactcggtcccgggagagaaggaggtggcgg
tctcggtcacccagtgtggagcataggacacgaaggccacattctcgtgagaagcatccc
cattccccagagaagaagggggctgtgagggaggtttccccagcccctgctccacagggg
gagccacggcaggatggagaccactctaccaagcctccagtctcagaagtaagtgtcttg
ccagaggtagtaagtgtcctgccagaggtggttgtggctgacctgaaccctccagaagtc
cctcctgtcctcgcagagtcagtttcatgtgtgcctgaggaccttgattatggtgattct
gtggaggcaggccacgtctttgaggatttttcaaatgaagccatcttcatccagctcgat
gatatgagctcacctccttcccctgagagtacagactcctcccctgagcgagacttccta
ccaaaccccatactgcccccagccagccttccacaaaacagtactttacctgtcacccag
agggaggtgttaccaattcacagtgaagatatctcaaagcctgcaccccagccattggcc
ccttcagaccagtgcctgctcaggcaggacactgtagagaccactgctacaactctgagc
accccaggtgtgttgcccatgggaaaggacagtcctttgctgagtgggagaggatgtgaa
gtggtcaggcccaaggatgctgtggccccggccccactgctgcgatccagaaccctggtg
aaaagagtcacctggaacctgcaggaagcagaggccagcaccccagccctggacagagat
ccaaggacaccacttcagaggccccagaggccccaggaaggagactgggatgcagaggac
agggccctcataggatttcagcaggcaccattctccgagctgccccctcccatccacgtg
ctccaggagtctgggttacctgatgcagatccctctcagccccctggtgttcccagggca
gaagggcctccagctgttgggactctgcactcagcagggggtattcttgcccaggtttac
agccccaacatgccaccacccctggctcagccctcaagcatcccgccctatgcactggtc
aaccagccctcagtccagttgattctgcaggggacccttcccctagcaggctgtggtgca
gcacagaacctggccccagtgcccactatgccagctacagcctcagagctagctgttcca
accaccaacaactcagaagaaaggacggctactcccaaaacagctgctgagaagaccaca
aaggaggagtacatgaagaagctgcacatgcaggaacgggctgtggaggaagtgaagctg
gccattaaacccttctaccagaagagagaggtgaccaaggaggagtacaaggacatcctg
cgcaaagctgtgcagaagatctgccacagcaagagtggcgaaatcaaccctgtaaaggtg
gccaacctggtgaaggcctatgtggacaaatacaggcatatgcgcaagcacaagaagact
gaagctggagaggagccacccactcaaggtgctgagacctga

DBGET integrated database retrieval system