KEGG   Rattus norvegicus (rat): 245956
Entry
245956            CDS       T01003                                 

Gene name
Scn3b, Scnb3
Definition
(RefSeq) sodium voltage-gated channel beta subunit 3
  KO
K04847  voltage-gated sodium channel type III beta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    245956 (Scn3b)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   245956 (Scn3b)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set Ig_6
Other DBs
NCBI-GeneID: 245956
NCBI-ProteinID: NP_620797
RGD: 621657
Ensembl: ENSRNOG00000057221
UniProt: Q9JK00
Position
8q22
AA seq 215 aa
MPAFNRLLPLASLVLIYWVRVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVV
EWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTC
NVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLFIEMIYC
YRKVSKAEEAAQENASDYLAIPSENKENSVVPVEE
NT seq 648 nt   +upstreamnt  +downstreamnt
atgcctgccttcaacagattgcttcccctagcttctctagtgctcatctactgggtcaga
gtctgcttccctgtgtgtgtggaagtaccctcggagacagaagcggtgcagggtaatccc
atgaagctgaggtgcatctcctgcatgaagagggaggaggtggaggccaccactgtggtg
gagtggttctacaggcctgagggcggtaaagatttccttatatatgagtatcggaatggc
caccaggaagtggagagccccttccaaggccgtctgcagtggaatgggagcaaagacctg
caggacgtatccatcactgtactcaatgtcactttgaatgactctggcctctacacatgc
aatgtgtccagggagttcgaattcgaggcacacaggccttttgtgaagaccacgagactg
atacctttgcgagtcactgaagaggcgggagaagacttcacctccgtggtctcggaaatc
atgatgtacatcctcctggtcttcctcaccttgtggctgtttattgagatgatctattgc
tacagaaaggtctctaaggccgaagaggcagcacaggaaaatgcgtctgactaccttgct
atcccttcagagaacaaggagaactctgtggtacctgtggaggaataa

DBGET integrated database retrieval system