KEGG   Rattus norvegicus (rat): 245959
Entry
245959            CDS       T01003                                 

Gene name
Slc25a3, Phc
Definition
(RefSeq) solute carrier family 25 member 3
  KO
K15102  solute carrier family 25 (mitochondrial phosphate transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    245959 (Slc25a3)
   04147 Exosome [BR:rno04147]
    245959 (Slc25a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   245959 (Slc25a3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   245959 (Slc25a3)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 245959
NCBI-ProteinID: NP_001257717
RGD: 70986
Ensembl: ENSRNOG00000008289
UniProt: Q6IRH6
Position
7q13
AA seq 357 aa
MFSSVAHLARANPFNAPHLQLVHDVSGPRSPPGPPRRSRHLAAAAVEEQYSCEYGSGRFF
ILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAP
TLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLAASASAEFFADIALAPMEA
AKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPYTMMKFACFERTVEAL
YKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTASQVLQR
LGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTE
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgttctcgtccgtagcgcacctggcgcgggcgaaccccttcaacgcgccacatctgcag
ctggtgcacgatgtgtcgggtccccgcagccccccaggtccgccccggcgttcccgccac
ctggctgccgccgccgtggaagagcagtatagctgtgaatatggatctggcagattcttt
atcctctgtggactcggaggaattattagctgtggcacaacacatacagcattggttcct
ctagatctggttaaatgcagaatgcaggtggaccctcagaagtacaagggcatatttaat
ggtttctccattacattgaaagaagatggcgttcgtggtttggctaaaggatgggcccca
actttgattggctattccatgcaagggctctgcaaattcggcttttatgaagtcttcaaa
gccttatatagcaacatacttggtgaggagaacacctatctgtggcgtacatcactgtat
ctagctgcttctgccagtgctgagttctttgctgacattgccctggctcctatggaagct
gctaaagttcgaattcaaacccagcctggctatgccaacacactgagggaagctgtcccc
aaaatgtataaagaagaaggcttaaatgcgttctacaagggtgttgctcctctgtggatg
agacagatcccatacaccatgatgaagttcgcctgctttgaacggactgttgaagctttg
tacaaatttgtggttcctaagccccgaagtgaatgtacaaaggcagagcagctggttgtg
acatttgtggcaggttacatagccggagtcttttgtgcgattgtctctcaccctgctgac
tctgtggtctctgtgctgaataaagagaaaggcagcactgcctctcaggtcctgcagagg
cttggctttagaggtgtatggaaggggctcttcgcccgaatcatcatgattggcactctg
acggcactgcagtggttcatctatgactctgtgaaggtctacttcaggctccctcgccct
cctccacctgagatgccagagtctctgaagaagaagcttgggttaactgagtag

DBGET integrated database retrieval system