KEGG   Rattus norvegicus (rat): 24596Help
Entry
24596             CDS       T01003                                 

Gene name
Ngfr, LNGFR, RNNGFRR, Tnfrsf16, p75, p75NTR
Definition
(RefSeq) nerve growth factor receptor
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04215  Apoptosis - multiple species
rno04722  Neurotrophin signaling pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24596 (Ngfr)
   04015 Rap1 signaling pathway
    24596 (Ngfr)
   04010 MAPK signaling pathway
    24596 (Ngfr)
   04151 PI3K-Akt signaling pathway
    24596 (Ngfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24596 (Ngfr)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    24596 (Ngfr)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    24596 (Ngfr)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    24596 (Ngfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    24596 (Ngfr)
   04090 CD molecules [BR:rno04090]
    24596 (Ngfr)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   24596 (Ngfr)
CD molecules [BR:rno04090]
 Proteins
  24596 (Ngfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21
Motif
Other DBs
NCBI-GeneID: 24596
NCBI-ProteinID: NP_036742
RGD: 3177
Ensembl: ENSRNOG00000005392
UniProt: P07174 G3V6P1
Structure
PDB: 

Position
10q26
AA seq 425 aa AA seqDB search
MRRAGAACSAMDRLRLLLLLILGMSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGA
NQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEET
GHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRE
CTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSS
QPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGE
KLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHL
AGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSEST
ATSPV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaggagggcaggtgctgcctgcagcgccatggaccggctgcgcctgctgctgctgctg
attctagggatgtcctctggaggtgccaaggagacatgttccacaggcctgtacacccac
agcggagagtgctgcaaagcctgcaacttgggcgaaggcgtggcccagccctgcggagcc
aaccagaccgtgtgtgaaccctgcctggacagtgttacattctccgatgtggtgagcgcc
actgagccgtgcaagccgtgcaccgagtgcctgggcctgcagagcatgtccgctccctgt
gtggaggcagacgatgcagtgtgcagatgtgcctatggctactaccaggacgaggagact
ggccactgtgaggcttgcagcgtgtgcgaggtgggctcgggactcgtgttctcctgccag
gacaaacagaacacagtgtgtgaagagtgcccagagggcacatactcagacgaagccaac
cacgtggacccgtgcctaccctgcacggtgtgcgaggacactgagcgccagttacgcgag
tgcacgccctgggctgatgctgaatgcgaagagatccctggtcgatggatcccaaggtct
acgcccccggagggctccgacagcacagcgcccagcacccaggagcctgaggttcctcca
gagcaagaccttgtacccagtacagtggcggatatggtgaccactgtgatgggcagctcc
cagcctgtagtgacccgcggcaccaccgacaacctcattcctgtctattgctccatcttg
gctgctgtggtcgtgggccttgtggcctatattgctttcaagaggtggaacagctgcaaa
caaaataaacaaggcgccaacagccgccccgtgaaccagacgcccccaccggagggagag
aaactgcacagcgacagtggcatctctgtggacagccagagcctgcacgaccagcagacc
catacgcagactgcctcaggccaggccctcaagggtgatggcaacctctacagtagcctg
cccctgaccaagcgtgaggaggtagagaaactgctcaacggggatacctggcgacatctg
gcaggcgagctgggttaccagcctgaacatatagactcctttacccacgaggcctgccca
gtgcgagccctgctggccagctggggtgcccaggacagtgcaacgcttgatgccctttta
gccgccctgcgacgcatccagagagctgacattgtggagagtctatgcagcgagtccact
gccacgtccccagtgtga

DBGET integrated database retrieval system