KEGG   Rattus norvegicus (rat): 245962
Entry
245962            CDS       T01003                                 

Gene name
Cd48, SLAMF2
Definition
(RefSeq) Cd48 molecule
  KO
K06479  CD48 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    245962 (Cd48)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    245962 (Cd48)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    245962 (Cd48)
CD molecules [BR:rno04090]
 Proteins
  245962 (Cd48)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  245962 (Cd48)
SSDB
Motif
Pfam: Ig_3 Ig_2 V-set ig I-set Adeno_E3_CR1 Borrelia_orfD RTX
Other DBs
NCBI-GeneID: 245962
NCBI-ProteinID: NP_620803
RGD: 620620
Ensembl: ENSRNOG00000004737
UniProt: P10252
Structure
PDB: 
2DRU

Position
13q24
AA seq 240 aa
MYFKKRRWFLILESLLLSLVTGFQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTT
NQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKI
TMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEI
TITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLARSSGVHWIAAWLVVTLSIIPSILLA
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtacttcaaaaaacggagatggtttctgatcctggaatcgcttttgctgtctttggta
actggatttcaagatcaatcagtaccaaatgtaaatgccataaccggcagcaacgtaacc
ctgacaatcctgaagcacccacttgcatcgtatcaacgtctcacctggcttcatactacc
aaccagaagattttagagtacttccctaatggtaaaaaaactgtcttcgagtctgtattt
aaagacagggtcgatcttgacaaaacaaatggtgcacttcgtatctataatgtctcgaaa
gaggacagaggtgactactacatgagaatgttgcacgaaactgaggaccagtggaagata
accatggaagtatacgatcttgtgtccaagcctgccatcaaaatcgagaagactaaaaat
ttgactgactcctgtcacctgaggctatcatgtaaggtagaggaccaaggtgttgactat
acttggtatgaggactcggggccctttccccaaaggaatccaggatatgtactcgaaatc
accatcactccacacaacaagtctacattttacacctgccaagtcagcaatcctgtaagc
agcgagaacgacacactgtactttattccaccttgtacgctggccagatcttctggagtc
cattggattgcagcttggctagtggtcacgttatccatcattcccagcatcctgctagcc
tga

DBGET integrated database retrieval system