KEGG   Rattus norvegicus (rat): 245977
Entry
245977            CDS       T01003                                 

Gene name
Adgrf5, Gpr116, Gprhep, Ig-Hepta
Definition
(RefSeq) adhesion G protein-coupled receptor F5
  KO
K08458  adhesion G-protein coupled receptor F5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    245977 (Adgrf5)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    245977 (Adgrf5)
Peptidases and inhibitors [BR:rno01002]
 Mixed peptidases
  Family P2
   245977 (Adgrf5)
G protein-coupled receptors [BR:rno04030]
 Adhesion receptor family
  Others
   245977 (Adgrf5)
SSDB
Motif
Pfam: 7tm_2 GPS Ig_3 ig SEA I-set GAIN Ig_2 V-set DUF5874 DUF2976 TMEM192
Other DBs
NCBI-GeneID: 245977
NCBI-ProteinID: NP_620810
RGD: 621679
Ensembl: ENSRNOG00000011154
UniProt: Q9WVT0
Position
9q13
AA seq 1349 aa
MKSSRTVTLYFVLIVICSSEATWSRPAEPIVHPLILQEHELAGEELLRPKRAVAVGGPVA
EEYTVDVEISFENVSFLESIRAHLNSLRFPVQGNGTDILSMAMTTVCTPTGNDLLCFCEK
GYQWPEERCLSSLTCQEHDSALPGRYCNCLKGLPPQGPFCQLPETYITLKIKVRLNIGFQ
EDLENTSSALYRSYKTDLERAFRAGYRTLPGFRSVTVTQFTKGSVVVDYIVEVASAPLPG
SIHKANEQVIQNLNQTYKMDYNSFQGTPSNETKFTVTPEFIFEGDNVTLECESEFVSSNT
SWFYGEKRSDIQNSDKFSIHTSIINNISLVTRLTIFNFTQHDAGLYGCNVTLDIFEYGTV
RKLDVTPIRILAKEERKVVCDNNPISLNCCSENIANWSRIEWKQEGKINIEGTPETDLES
SCSTYTLKADGTQCPSGSSGTTVIYTCEFVSVYGAKGSKNIAVTFTSVANLTITPDPISV
SEGQSFSITCLSDVSSFDEVYWNTSAGIKIHPRFYTMRRYRDGAESVLTVKTSTREWNGT
YHCIFRYKNSYSIATKDVTVHPLPLESDIMMDPLEASGLCTSSHQFKCCIEENDGEEYIV
TFHVDSSSFPAEREVIGKQACYTYSLPGKLPSRCPKDIDVFCHFTNAANSSVRSPSMKLT
LVPGKNITCQDPIIGIGEPGKVIQKLCQFAGVSRSPGQTIGGTVTYKCVGSQWKEETRAC
ISAPINGLLQLAKALIKSPSQDQKLPKYLRDLSVSTGKEEQDIRSSPGSLGAIISILDLL
STVPTQVNSEMMRDILATINVILDKSTLNSWEKLLQQQSNQSSQFLQSVERFSKALELGD
STPPFLFHPNVQMKSMVIKRGHAQMYQQKFVFTDSDLWGDVAIDECQLGSLQPDSSIVTV
AFPTLKAILAQDGQRKTPSNSLVMTTTVSHNIVKPFRISMTFKNNHRSGGKPQCVFWNFS
LANNTGGWDSSGCTVEDDGRDNRDRVFCKCNHLTSFSILMSPDSPDPGSLLKILLDIISY
IGLGFSIVSLAACLVVEAMVWKSVTKNRTSYMRHICIVNIALCLLIADIWFIVAGAIHDG
HYPLNETACVAATFFIHFFYLSVFFWMLTLGLMLFYRLIFILHDASKSTQKAIAFSLGYG
CPLIISSITVGVTQPQEVYMRKNACWLNWEDTRALLAFAIPALIIVVVNVSITVVVITKI
LRPSVGDKPGKQEKSSLFQISKSIGVLTPLLGLTWGFGLATVIQGSNAVFHIIFTLLNAF
QGLFILLFGCLWDQKVQEALLHKFSLSRWSSQHSKSTSLGSSTPVFSMSSPISRRFNNLF
GKTGTYNVSTPETTSSSVENSSSAYSLLN
NT seq 4050 nt   +upstreamnt  +downstreamnt
atgaaatcgtcaaggactgtcacgctctactttgtgcttattgtgatttgttcctcagaa
gctacatggagcaggccagcagagcccattgtccatcctttgattctccaagaacatgaa
ctagcaggggaagagctactgaggccaaaaagagcagttgcagtgggtggtcctgtggca
gaagaatacaccgtggatgttgagatcagttttgaaaatgtctccttcctggagtccatc
agagctcacttaaacagcctccgttttccagttcaggggaacggcactgacattttgagt
atggcaatgactacagtctgcactcctactgggaatgacctcttgtgcttctgcgagaaa
ggctaccagtggcctgaggaaaggtgtctctcctctctcacttgtcaagagcatgacagc
gccctgccaggccgatactgcaattgtctgaaaggacttcctccccaaggacctttctgc
cagctcccagaaacatacattaccttaaaaatcaaagtcagactgaacataggatttcaa
gaagacctagagaacacatcctctgccctctataggtcctacaagactgatctggaaaga
gcgttccgagcgggttacagaactttaccaggattcagatcggtgactgtgacacagttc
accaagggcagcgtggttgtggactacatagtcgaggttgcatcggcaccactgcctgga
tcaattcataaagccaatgagcaagtcatacagaacctcaaccagacttacaaaatggac
tacaactccttccaaggaacaccaagcaatgaaacaaagttcactgtgacaccagagttc
atctttgaaggagacaatgtaactctggaatgcgaaagtgaattcgtgtcctccaacaca
tcttggttctatggagaaaaacggtctgacatccagaacagtgacaaattctccattcac
acctcaatcatcaacaatataagcctggtcacccgcctcactattttcaacttcacacag
catgatgcaggcttatatggttgcaatgtgacactggatatttttgaatatgggacagtc
agaaaattagatgtcactcccatccggattttggccaaggaagagagaaaggtggtgtgt
gacaataaccctatatcgttgaactgctgcagcgagaatatcgcgaactggagcagaatc
gagtggaaacaggaggggaaaataaacattgaagggaccccagaaacagacctagagtct
agctgcagcacttatacactcaaggcagatggaacccagtgtcccagtggttcttctgga
acaacagtcatctacacgtgtgagttcgtcagcgtctacggagccaaaggcagtaagaac
atagccgtgaccttcacctctgtagccaacctaacaataaccccggacccaatttctgtt
tctgagggacaaagcttttctataacttgcctcagcgatgtgagtagctttgatgaggtg
tactggaacacttccgctggtattaaaatccatccaaggttttataccatgaggaggtat
cgggatggagcagagtcggtgctgacggtgaagacctccaccagagagtggaacggaacc
taccactgcatatttagatataagaattcatacagcatagccaccaaagatgtcactgtt
caccctctgcctctggagtcagacatcatgatggatcctttggaagccagtggtctgtgc
accagttcccatcagttcaagtgctgcatagaagagaacgatggggaagagtacattgtg
actttccacgtggattcctcatcctttcctgctgaaagagaagttattggcaagcaggca
tgctacacatacagtctcccaggaaagttaccatcacggtgtcccaaagacattgacgtg
ttctgccactttaccaatgcagccaacagctcagtccggagcccatctatgaagcttacc
cttgttccagggaagaatatcacatgccaggatcccatcataggtattggggaacctggg
aaagtcatccagaagctgtgccagtttgcaggtgtttctagaagccctggacagaccatt
ggtggaaccgtcacttataaatgtgtaggctcccagtggaaggaggagacaagggcctgc
atatcagccccaatcaatggtttgctccagttggccaaggctttgatcaagagcccctcc
caggatcagaagctccctaaatacctgcgggacctttctgttagcactgggaaggaagaa
caggatatacgctcatcgcccgggagcctgggagccatcatcagcatccttgatttgctt
tcaacagttcccactcaagtgaattcagaaatgatgagggatatacttgctaccattaat
gtcatcttagacaagtccaccttgaactcctgggagaagttactacagcaacagagcaac
cagagctctcagttcctgcagtcagtggagaggttttccaaagcgctcgagctgggagac
agcacccctcccttcctcttccaccctaatgttcagatgaagagcatggtgataaaacgt
ggccacgcccaaatgtaccaacagaaatttgtcttcacagactctgacctatggggtgat
gtagccattgatgagtgtcagctgggaagcttgcagcctgattcatcgatcgttactgtg
gctttcccaactctcaaagccatcctggcccaggatggacagagaaagacaccctccaac
agcctagtaatgaccaccactgtcagccataatatcgtcaagccttttaggatttctatg
acattcaagaacaaccatcgttcgggtggcaagccacagtgtgtcttctggaacttcagc
cttgccaataatacagggggctgggatagcagtgggtgcactgtggaagatgatggtagg
gacaatagggacagagtcttctgcaagtgtaaccacctgacgtcattctccattctcatg
tccccagactccccagacccaggatctcttttaaaaatacttctggatatcatttcttac
atcgggttgggcttttccatagtcagcttagctgcctgtctagttgtggaagccatggtg
tggaaatcagtgaccaagaaccgaacttcctatatgcgccacatctgcatcgtcaacatt
gccctttgccttctgattgctgacatctggttcattgtggctggtgctatccacgatggg
cattacccactcaacgaaacagcctgtgtggccgccacattcttcattcacttcttctac
ctcagtgtcttcttctggatgctaactctgggcctcatgctcttctaccggctgattttc
attctacatgacgcgagcaagtccacgcagaaagccattgccttttctctaggctatggc
tgtccactcattatctcatccatcacagtgggggttacacagccacaggaagtttacatg
aggaagaatgcatgttggctcaactgggaggacaccagagcactgctggcttttgctatc
ccagcgttgattattgtggtggtgaacgtgagcatcacagttgtggtcatcaccaagatc
ctaaggccctccgtcggagacaagccaggcaagcaggaaaagagcagcctattccagatc
agcaagagcattggagtcctcacgccactcttggggctcacttggggttttggtctggcc
acagtgatccaggggagcaatgctgtgttccacatcatatttactctcctcaatgccttt
caggggctcttcattttgctctttggctgcctctgggatcagaaggtacaggaagctttg
ctgcataagttttcattgtcaaggtggtcttctcaacactcaaagtcaacatccttaggt
tcatcaacacctgtgttttcgatgagttctccgatatcccgaagatttaataatcttttt
ggtaaaacaggaacatataacgtttccaccccagagacaaccagctcatccgtggaaaat
tcctctagtgcttactcattgctcaactag

DBGET integrated database retrieval system