KEGG   Rattus norvegicus (rat): 24598
Entry
24598             CDS       T01003                                 

Gene name
Nos1
Definition
(RefSeq) nitric oxide synthase, brain
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04145  Phagosome
rno04371  Apelin signaling pathway
rno04713  Circadian entrainment
rno04730  Long-term depression
rno04926  Relaxin signaling pathway
rno04970  Salivary secretion
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    24598 (Nos1)
   00330 Arginine and proline metabolism
    24598 (Nos1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    24598 (Nos1)
   04020 Calcium signaling pathway
    24598 (Nos1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24598 (Nos1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    24598 (Nos1)
  09154 Digestive system
   04970 Salivary secretion
    24598 (Nos1)
  09156 Nervous system
   04730 Long-term depression
    24598 (Nos1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24598 (Nos1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24598 (Nos1)
   05014 Amyotrophic lateral sclerosis
    24598 (Nos1)
   05022 Pathways of neurodegeneration - multiple diseases
    24598 (Nos1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     24598 (Nos1)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 PDZ PDZ_6 PDZ_2 Flavodoxin_5
Other DBs
NCBI-GeneID: 24598
NCBI-ProteinID: NP_434686
RGD: 3184
Ensembl: ENSRNOG00000001130
UniProt: P29476
Structure
PDB: 
1QAU 6NGM 6AUS 6AUW 4FVY 3N5W 6AUR 5VUN 1OM4 6NGJ 6AUV 6NGX 4D7O 4CTV 3N66 1P6K 5VUO 5FW0 4UH1 4D3B 4CX5 4GQE 3N5X 3N65 3JT4 4FVW 3NM0 6NGR 5UNY 4CTX 6NGK 6NGL 6NGV 5FVT 4CAM 5FVR 5AGM 3RQJ 6AUU 5G0O 4KCN 4K5G 3NLM 2G6M 6NGW 4LUX 4KCO 3NLX 3PNG 4D2Z 4K5E 3UFU 6NGN 6NGS 6NH0 6AUT 6AUX 5UNS 5AD5 5AD8 5AGO 4UPM 4CX6 4CTW 3TYL 3N2R 2G6I 2G6N 1ZZQ 1ZZU 1P6I 1F20 1QAV 4UPP 4CAN 3HSN 4JSJ 3NLZ 6NGY 4KCL 3TYO 3RQL 3JWU 6NGT 5VUP 5G0N 5AGL 4JSG 3PNF 6NGQ 6AUQ 5VUJ 5VUK 5VUS 5UNR 5UNZ 5FVQ 5FVS 5AD7 4UH4 5AGN 4D31 4UPO 4CAQ 4FW0 3RQM 3RQN 3N61 3N62 3N64 3JWS 3JX3 3JT8 3B3M 1RS6 1RS7 5VUU 4D30 4V3Y 5VUR 5UO0 4CX3 4JSE 3UFS 3TYN 3PNE 3NNZ 6NGP 5AD4 5ADA 4D2Y 4CX4 4CAO 4C39 3N60 3JWV 3B3N 1P6H 4UH2 4V3X 4FVZ 3NLY 6NGU 6NGZ 6NHE 5VUL 5VUQ 5VUT 5UNV 5AD6 5AGK 4CTQ 4CDT 4FVX 3UFW 3TYM 3NLN 3N63 3JX1 2HX3 2G6H 2G6K 1ZVI 1VAG 1P6J 1MMV 1MMW 1LZX 3JWT 3NLK 3NLP 3HSO 5UNX 4UH3 4IMU 5UNW 4UH0 5UNT 5UNU 5ADB 4V3Z 4CTP 4KCJ 4JSF 3SVP 3N5Y 3B3O 2G6L 1ZZR 1LZZ 1M00 5VUI 4V3V 4CAP 3UFQ 4KCM 4UGZ 3UFT 3UFV 4UPN 4JSI 6NHD 5VUM 5G0P 5FVP 5ADC 5ADD 5ADE 5AGP 4D32 4KCK 4K5D 3UFP 3UFR 3NNY 3NLR 3NLV 3NLW 3JX2 3JT5 3JT7 3JT9 1QW6 4V3W 4EUX 4KCH 4IMS 3Q99 3NLQ 3JX5 3JT3 2HX4 1K2R 4CTU 3UFO 3SVQ 3N5Z 3JTA 4CTR 4K5F 4IMT 4IMW 3NLJ 3JX0 3JT6 3HSP 1K2T 1K2U 3RQK 3Q9A 3JX4 4KCI 4HOP 5AD9 4CTT 3NLO 3N5V 2G6J 1TLL 1QWC 1OM5 4JSH 3JX6 3DQR 3B3P 1ZVL 1K2S 3FC5 1B8Q

Position
12
AA seq 1463 aa
MEENTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPPTKAVDLSHQPSASKDQSLAVDRVTGLGNGPQHAQGHGQGAGSVSQANGVAI
DPTMKSTKANLQDIGEHDELLKEIEPVLSILNSGSKATNRGGPAKAEMKDTGIQVDRDLD
GKSHKAPPLGGDNDRVFNDLWGKDNVPVVLNNPYSEKEQSPTSGKQSPTKNGSPSRCPRF
LKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSQHTRKPEDVRTKDQLFPLAKE
FLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQ
WSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLI
RYAGYKQPDGSTLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPEL
VLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCD
NSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIK
HMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTN
GTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHA
FDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKY
PEPLRFFPRKGPSLSHVDSEAHSLVAARDSQHRSYKVRFNSVSSYSDSRKSSGDGPDLRD
NFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEA
FRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTYVAEAPDLTQGLSN
VHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNA
LIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTP
LQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQ
LSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPC
FVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQS
KIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHI
YVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTN
RLRSESIAFIEESKKDADEVFSS
NT seq 4392 nt   +upstreamnt  +downstreamnt
atggaagagaacacgtttggggttcagcagatccaacccaatgtaatttctgttcgtctc
ttcaaacgcaaagtgggaggtctgggcttcctggtgaaggaacgggtcagcaagcctccc
gtgatcatctcagacctgattcgaggaggtgctgcggagcagagcggccttatccaagct
ggagacatcattctcgcagtcaacgatcggcccttggtagacctcagctatgacagtgcc
ctggaggttctcaggggcattgcctctgagacccacgtggtcctcattctgaggggccct
gagggcttcactacacatctggagaccaccttcacaggggatggaacccccaagaccatc
cgggtgacccagcccctcggtcctcccaccaaagccgtcgatctgtctcaccagccttca
gccagcaaagaccagtcattagcagtagacagagtcacaggtctgggtaatggccctcag
catgcccaaggccatgggcagggagctggctcagtctcccaagctaatggtgtggccatt
gaccccacgatgaaaagcaccaaggccaacctccaggacatcggggaacatgatgaactg
ctcaaagagatagaacctgtgctgagcatcctcaacagtgggagcaaagccaccaacaga
gggggaccagccaaagcagagatgaaagacacaggaatccaggtggacagagacctcgat
ggcaaatcgcacaaagctccgcccctgggcggggacaatgaccgcgtcttcaatgacctg
tgggggaaggacaacgttcctgtggtccttaacaacccgtattcagagaaggaacagtcc
cctacctcggggaaacagtctcccaccaagaacggcagcccttccaggtgcccccgtttc
ctcaaggtcaagaactgggagacggacgtggtcctcaccgacaccctgcacctgaagagc
acactggaaacggggtgcacagagcacatctgcatgggctcgatcatgctgccttcccag
cacacgcggaagccagaagatgtccgcacaaaggaccagctcttccctctagccaaagaa
tttctcgaccaatactactcatccattaagagatttggctccaaggcccacatggacagg
ctggaggaggtgaacaaggagattgaaagcaccagcacctaccagctcaaggacaccgag
ctcatctatggcgccaagcatgcctggcggaacgcctctcgatgtgtgggcaggatccag
tggtccaagctgcaggtgttcgatgcccgagactgcaccacagcccacggcatgttcaac
tacatctgtaaccatgtcaagtatgccaccaacaaagggaatctcaggtcggccatcacg
atattccctcagaggactgacggcaaacatgacttccgagtgtggaactcgcagctcatc
cgctacgcgggctacaagcagccagatggctctaccttgggggatccagccaatgtgcag
ttcacggagatctgtatacagcagggctggaaagccccaagaggccgcttcgacgtgctg
cctctcctgcttcaggccaatggcaatgaccctgagctcttccagatccccccagagctg
gtgctggaagtgcccatcaggcaccccaagttcgactggtttaaggacctggggctcaaa
tggtatggcctccccgctgtgtccaacatgctgctggagatcgggggcctggagttcagc
gcctgtcccttcagcggctggtacatgggcacagagatcggcgtccgtgactactgtgac
aactctcgatacaacatcctggaggaagtagccaagaagatggatttggacatgaggaag
acctcgtccctctggaaggaccaagcactggtggagatcaacattgctgttctatatagc
ttccagagtgacaaggtgaccatcgttgaccaccactctgccacggagtccttcatcaaa
cacatggagaatgaataccgctgcagagggggctgccccgccgactgggtgtggattgtg
cctcccatgtcgggcagcatcacccctgtcttccaccaggagatgctcaactatagactc
accccgtcctttgaataccagcctgatccatggaacacccacgtgtggaagggcaccaac
gggacccccacgaagcggcgagctatcggctttaagaaattggcagaggccgtcaagttc
tcagccaagctaatggggcaggccatggccaagagggtcaaggcgaccattctctacgcc
acagagacaggcaaatcacaagcctatgccaagaccctgtgtgagatcttcaagcacgcc
ttcgatgccaaggcaatgtccatggaggagtatgacatcgtgcacctggagcacgaagcc
ctggtcttggtggtcaccagcacctttggcaatggagacccccctgagaacggggagaaa
ttcggctgtgctttaatggagatgaggcaccccaactctgtgcaggaggagagaaagtac
ccggaacccttgcgtttctttccccgtaaagggccttccctctcccatgttgactctgaa
gcccacagtctggttgctgcccgtgacagccaacacaggagctacaaggtccgattcaac
agcgtctcctcctattctgactcccgaaagtcatcgggcgacggacccgacctcagagac
aactttgaaagtactggacccctggccaatgtgaggttctcagtgttcggcctcggctct
cgggcgtacccccacttctgtgcctttgggcatgcggtggacaccctcctggaggaactg
ggaggggagaggattctgaagatgagggagggggatgagctttgcggacaggaagaagct
ttcaggacctgggccaagaaagtcttcaaggcagcctgtgatgtgttctgcgtgggggat
gacgtcaacatcgagaaggcgaacaactccctcattagcaatgaccgaagctggaagagg
aacaagttccgcctcacgtatgtggcggaagctccagatctgacccaaggtctttccaat
gttcacaaaaaacgagtctcggctgctcgactcctcagccgccaaaacctgcaaagccct
aagtccagccgatcgaccatcttcgtgcgtctccacaccaacgggaatcaggagctgcag
taccagccaggggaccacctgggtgtcttccccggcaaccacgaggacctcgtgaatgca
ctcattgaacggctggaggatgcaccgcctgccaaccacgtggtgaaggtggagatgctg
gaggagaggaacactgctctgggtgtcatcagtaattggaaggatgaatctcgcctccca
ccctgcaccatcttccaggccttcaagtactacctggacatcaccacgccgcccacgccc
ctgcagctgcagcagttcgcctctctggccactaatgagaaagagaagcagcggttgctg
gtcctcagcaaggggctccaggaatatgaggagtggaagtggggcaagaaccccacaatg
gtggaggtgctggaggagttcccgtccatccagatgccggctacacttctcctcactcag
ctgtcgctgctgcagcctcgctactactccatcagctcctctccagacatgtaccccgac
gaggtgcacctcaccgtggccatcgtctcctaccacacccgagacggagaaggaccggtc
caccacggggtgtgctcctcctggctcaacagaatacaggctgacgatgtagtcccctgc
ttcgtgagaggtgcccctagcttccacctgcctcgaaacccccaggtgccttgcatcctg
gttggcccaggcactggcatcgcacccttccgaagcttctggcaacagcgacaatttgac
atccaacacaaaggaatgaatccgtgccccatggttctggtctttgggtgtcgacaatcc
aagatagatcatatctacagagaggagaccctgcaggccaagaacaagggcgtcttcaga
gagctgtacactgcctattcccgggaaccggacaggccaaagaaatatgtacaggacgtg
ctgcaggaacagctggctgagtctgtgtaccgcgccctgaaggagcaaggaggccacatt
tatgtctgtggggacgttaccatggccgccgatgtcctcaaagccatccagcgcataatg
acccagcaggggaaactctcagaggaggacgctggtgtattcatcagcaggctgagggat
gacaaccggtaccacgaggacatctttggagtcaccctcagaacgtatgaagtgaccaac
cgccttagatctgagtccatcgccttcatcgaagagagcaaaaaagacgcagatgaggtt
ttcagctcctaa

KEGG   Rattus norvegicus (rat): 24599
Entry
24599             CDS       T01003                                 

Gene name
Nos2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04146  Peroxisome
rno04371  Apelin signaling pathway
rno04926  Relaxin signaling pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05133  Pertussis
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    24599 (Nos2)
   00330 Arginine and proline metabolism
    24599 (Nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    24599 (Nos2)
   04066 HIF-1 signaling pathway
    24599 (Nos2)
   04020 Calcium signaling pathway
    24599 (Nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    24599 (Nos2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    24599 (Nos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24599 (Nos2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    24599 (Nos2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    24599 (Nos2)
   05152 Tuberculosis
    24599 (Nos2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24599 (Nos2)
   05145 Toxoplasmosis
    24599 (Nos2)
   05140 Leishmaniasis
    24599 (Nos2)
   05142 Chagas disease
    24599 (Nos2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24599 (Nos2)
   05014 Amyotrophic lateral sclerosis
    24599 (Nos2)
   05022 Pathways of neurodegeneration - multiple diseases
    24599 (Nos2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     24599 (Nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 KCTD11_21_C
Other DBs
NCBI-GeneID: 24599
NCBI-ProteinID: NP_036743
RGD: 3185
Ensembl: ENSRNOG00000057443
UniProt: Q06518
Position
10
AA seq 1147 aa
MACPWKFLFRVKSYQGDLKEEKDINNNVEKTPGAIPSPTTQDDPKSHKHQNGFPQFLTGT
AQNVPESLDKLHVTPSTRPQHVRIKNWGNGEIFHDTLHHKATSDISCKSKLCMGSIMNSK
SLTRGPRDKPTPVEELLPQAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTL
DELIFATKMAWRNAPRCIGRIQWSNLQVFDARSCSTASEMFQHICRHILYATNSGNIRSA
ITVFPQRSDGKHDFRIWNSQLIRYAGYQMPDGTIRGDPATLEFTQLCIDLGWKPRYGRFD
VLPLVLQAHGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVGGLE
FPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRSMGLETHTLASLWKDRAVTEINAAVL
HSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEMLNY
VLSPFYYYQIEPWKTHIWQDEKLRPRRREIRFTVLVKAVFFASVLMRKVMASRVRATVLF
ATETGKSEALARDLAALFSYAFNTKVVCMEQYKANTLEEEQLLLVVTSTFGNGDCPSNGQ
TLKKSLFMMKELGHTFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELS
GQEDAFRSWAVQTFRAACETFDVRSKHCIQIPKRYTSNATWEPEQYKLTQSPESLDLNKA
LSSIHAKNVFTMRLKSLQNLQSEKSSRTTLLVQLTFEGSRGPSYLPGEHLGIFPGNQTAL
VQGILERVVDCSSPDQTVCLEVLDESGSYWVKDKRLPPCSLRQALTYFLDITTPPTQLQL
HKLARFATEETHRQRLEALCQPSEYNDWKFSNNPTFLEVLEEFPSLRVPAAFLLLQLPIL
KPRYYSISSSQDHTPSEVHLTVAVVTYRTRDGQGPLHHGVCSTWINNLKPEDPVPCFVRS
VSGFQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDSQHRGLKGGRMTLVFGCRHPEEDH
LYQEEMQEMVRKGVLFQVHTGYSRLPGKPKVYVQDILQKELADEVFSVLHGEQGHLYVCG
DVRMARDVATTLKKLVAAKLNLSEEQVEDYFFQLKSQKRYHEDIFGAVFSYGAKKGNTLE
EPKGTRL
NT seq 3444 nt   +upstreamnt  +downstreamnt
atggcttgcccctggaagtttctcttcagagtcaaatcctaccaaggtgacctgaaagag
gaaaaggacattaacaacaacgtggagaaaaccccaggtgctattcccagcccaacaaca
caggatgaccctaagagtcacaagcatcaaaatggtttcccccagttcctcactgggact
gcacagaatgttccagaatccctggacaagctgcatgtgactccatcgacccgcccacag
cacgtgaggatcaaaaactggggcaatggagagatttttcacgacacccttcaccacaag
gccacctcggatatctcttgcaagtccaaattatgcatggggtccatcatgaactccaag
agtttgaccagaggacccagagacaagcccaccccagtggaggagcttctgcctcaagcc
attgaattcattaaccagtattatggctccttcaaagaggcaaaaatagaggaacatctg
gccaggctggaagccgtaacaaaggaaatagaaacaacaggaacctaccagctcactctg
gatgagctcatctttgccaccaagatggcctggaggaacgcccctcgctgcatcggcagg
attcagtggtccaacctgcaggtcttcgatgcccggagctgtagcactgcatcagaaatg
ttccagcatatctgcagacacatactttacgccactaacagtggcaacatcaggtcggcc
attactgtgttcccccagcggagcgatgggaagcatgacttccggatctggaattcccag
ctcatccggtacgctggctaccagatgcccgatggcaccatcagaggggatcctgccacc
ttggagttcacccagttgtgcatcgacctgggctggaagccccgctatggccgcttcgat
gtgctgcctctggtcctgcaggctcacggtcaagatccagaggtctttgaaatccctcct
gatcttgtgctggaggtgaccatggagcatcccaagtacgagtggttccaggagctcggg
ctgaagtggtatgcgctgcctgccgtggccaacatgctcctggaggtgggtggcctcgag
ttcccagcctgccccttcaatggttggtacatgggcaccgagattggagtccgagacttc
tgtgacacacagcgctacaacatcctggaggaagtgggcaggagcatgggcctggagacc
cacacactggcctccctctggaaagaccgggctgtcaccgagatcaatgcagctgtgctc
catagttttcagaagcagaatgtgaccatcatggaccaccacacagcctcagagtccttc
atgaagcacatgcagaatgagtaccgggcccgaggaggctgccctgcagactggatttgg
ctggtccctccggtgtccgggagcatcacccctgtgttccaccaggagatgttgaactac
gtcctatctccattctactactaccagatcgagccctggaagacccacatctggcaggat
gagaagctgaggcccaggaggagagagatccggttcacagtcttggtgaaagcggtgttc
tttgcttctgtgctaatgcggaaggtcatggcttcccgcgtcagagccacagtcctcttt
gctactgagacaggaaagtcggaagcgctagccagggacctggctgccttgttcagctac
gccttcaacaccaaggttgtctgcatggaacagtataaggcaaacaccttggaagaggaa
caactactgctggtggttacaagcacatttggcaatggagactgccccagcaatgggcag
actctgaagaaatctctgttcatgatgaaagaactcgggcataccttcaggtatgcggta
tttggcctgggctccagcatgtaccctcagttctgtgcctttgctcatgacatcgaccag
aaactgtctcacctgggagcctcccagcttgccccaaccggagaaggggacgaactcagc
gggcaggaggacgccttccgcagctgggctgtgcaaaccttccgggcagcctgtgagacg
ttcgatgttcgaagcaaacattgcattcagatcccgaaacgctacacttccaacgcaaca
tgggagccagagcagtacaagctcacccagagcccagagtctctagacctcaacaaagct
ctcagcagcatccacgccaagaacgtgttcaccatgaggctgaaatccctccagaatctg
cagagtgagaagtccagccgcaccaccctccttgttcaactcaccttcgagggcagccga
ggccccagctacctacctggggaacacctggggattttcccaggcaaccagacggccctg
gtgcaagggatcttggagcgagttgtggattgttcttcgccagaccaaactgtgtgcctg
gaggttctagatgagagtggcagctactgggtcaaagacaagaggcttcccccctgctca
ctcaggcaagccctcacctacttcctggacatcactacccctcccacccagctgcagctc
cacaagctggcccgctttgccacggaagagacgcacaggcagaggttggaggccttgtgt
cagccctcagagtacaacgattggaagttcagcaacaaccccacgttcctggaggtgctg
gaagagttcccatcattgcgtgtgcctgctgccttcctgctgttgcagctccccattctg
aagccccgctactactccatcagctcctcccaggaccacaccccctcggaggtccacctc
actgtggctgtggtcacctatcgcacccgagatggtcagggtcccctgcaccatggcgtc
tgcagcacttggatcaataacctgaagcccgaagacccagtgccctgctttgtgcggagt
gtcagtggcttccagctccctgaggacccctcccagccctgcatcctcattgggcccggt
acaggcattgcccccttccgaagtttctggcagcagcggctccatgactctcagcacaga
gggctcaaaggaggccgcatgaccttggtgtttgggtgcaggcacccagaggaggaccac
ctctatcaggaagaaatgcaggagatggtccgcaagggagtgttgttccaggtgcacaca
ggctactcccggctgcccggaaaacccaaggtctacgttcaagacatcctgcagaaagag
ctggccgacgaggtgttcagcgtgctccacggggagcagggccacctttatgtttgtggc
gatgtgcgcatggctcgggatgtggctaccactttgaagaagctggtggccgccaagctg
aacttgagtgaggagcaggttgaggattacttcttccagctcaagagccagaaacgttat
catgaggatatcttcggtgcggtcttttcctatggagcaaaaaagggcaacaccttggag
gagcccaaaggcacaagactctga

KEGG   Rattus norvegicus (rat): 24600
Entry
24600             CDS       T01003                                 

Gene name
Nos3
Definition
(RefSeq) nitric oxide synthase, endothelial
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04066  HIF-1 signaling pathway
rno04071  Sphingolipid signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04611  Platelet activation
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    24600 (Nos3)
   00330 Arginine and proline metabolism
    24600 (Nos3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    24600 (Nos3)
   04371 Apelin signaling pathway
    24600 (Nos3)
   04066 HIF-1 signaling pathway
    24600 (Nos3)
   04020 Calcium signaling pathway
    24600 (Nos3)
   04071 Sphingolipid signaling pathway
    24600 (Nos3)
   04022 cGMP-PKG signaling pathway
    24600 (Nos3)
   04151 PI3K-Akt signaling pathway
    24600 (Nos3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24600 (Nos3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24600 (Nos3)
   04921 Oxytocin signaling pathway
    24600 (Nos3)
   04926 Relaxin signaling pathway
    24600 (Nos3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24600 (Nos3)
   05418 Fluid shear stress and atherosclerosis
    24600 (Nos3)
   05415 Diabetic cardiomyopathy
    24600 (Nos3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    24600 (Nos3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24600 (Nos3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     24600 (Nos3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 24600
NCBI-ProteinID: NP_068610
RGD: 3186
Ensembl: ENSRNOG00000009348
UniProt: Q62600
Position
4
AA seq 1202 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSQAPVPPSPTRPAPDHSPPLTR
PPDGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQSRPTQGPSPTE
QLLGQARDFINQYYNSIKRSGSQAHEQRLQEVEAEVVATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCRTAQEMFTYICNHIKYATNRGNLRSAITVFPQRYAGRGDF
RIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPE
LFTLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSSE
IGMRDLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLYSYQLAKVTIVDHH
AATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWK
GSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSP
RPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAAR
DIFSPKRSWKRQRYRLSTQAESLQLLPGLTHVHRRKMFQATILSVENLQSSKSTRATILV
RLDTGSQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPPSTEPVAVEQLEKGSPGGPP
PGWVRDPRLPPCTLRQALTYFLDITSPPSPRLLRLLSTLAEESSEQQELEALSQDPRRYE
EWKWFRCPTLLEVLEQFPSVALPAPLILTQLPLLQPRYYSVSSAPSAHPGEIHLTVAVLA
YRTQDVLGPLHYGVCSTWMSQLKAGDPVPCFIRGAPSFRLPPDPNLPCILVGPGTGIAPF
RGFWQDRLHDIEIKGLQPAPMTLVFGCRCSQLDHLYRDEVLDAQQRGVFGQVLTAFSRDP
GSPKTYVQDLLRTELAAEVHRVLCLEQGHMFVCGDVTMATSVLQTVQRILATEGSMELDE
AGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWSFDPPTQETP
GS
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcctgggccaccctgtggcctagggctcggg
ctgggcctagggctatgcggcaagcagggcccagcctcaccggcaccagagcctagccag
gcaccagtacccccgtccccaacccgaccagcaccagaccacagccccccgttaacccgg
cccccagacggacccaagtttcctcgagtaaagaactgggaagtgggcagcatcacctac
gataccctcagtgcacaggctcagcaggatgggccctgtaccccaagacgctgcttggga
tccctggtatttccaaggaagttacagagccggcccacccagggcccttcacccactgag
cagctattgggtcaagcccgggacttcatcaatcagtactataactcgatcaaaaggagt
ggttcccaggctcatgagcagcggcttcaggaagtggaagctgaggtggtggccacgggc
acctaccagctccgggagagtgagctggtgtttggggccaaacaggcctggcgcaacgct
ccccgctgtgtggggcggatccagtgggggaaactgcaggtatttgatgctcgggactgc
aggacagcacaggaaatgttcacctacatctgtaaccacattaagtatgcaacaaaccga
ggcaatcttcgttcagccatcacggtgttcccccagcgctacgctggccggggagacttc
cggatctggaacagccagctggtgcgctacgcgggctataggcagcaggacggctctgtg
cgaggggaccctgccaacgtggagatcactgagctctgtattcaacatggctggacccca
ggaaatggccgctttgatgtgctgcccctgctactccaggctcccgatgagcccccagaa
ctcttcactctgcccccagagctggtcctcgaggtgcctctggagcaccccacgctagag
tggtttgctgcccttggcctgcgctggtatgccctcccagctgtgtccaatatgctgcta
gaaatcgggggcctggagtttccggctgcccctttcagcggctggtacatgagttcagag
attggcatgagggacctgtgtgaccctcaccgatacaacatacttgaggatgtggctgtc
tgcatggatctagacacccggacaacctcatcactgtggaaagacaaggcagcagtggaa
attaacgtggctgtgctgtacagttaccagctggccaaagtgaccattgtggaccaccat
gccgccacagcctccttcatgaagcacttggaaaatgagcagaaggccagagggggctgc
cccgctgactgggcctggatcgtgccccccatctcaggcagcctcacccctgtcttccat
caagagatggtcaactatttcctgtcccctgccttccgctaccagcctgacccctggaaa
ggaagtgcagcaaaaggcacaggcatcaccaggaagaagacttttaaggaagtagccaat
gcagtgaagatctctgcctcactcatgggcacggtgatggcgaagcgtgtgaaggcgact
atcctgtatggctctgagactggccgcgcccagagctacgcacagcagctggggaggctc
tttcggaaggcgtttgacccccgggtcctgtgcatggatgaatacgatgtggtatcccta
gagcatgaggccttggtattggtggtgaccagcacatttggcaatggggatcccccggag
aatggagagagctttgcagcagcgctgatggaaatgtcgggcccctacaacagctcccct
cggcctgagcagcacaagagttacaaaatccgattcaacagtgtctcctgctcggaccca
ctggtatcctcttggcggcgcaaaaggaaggaatccagtaacacagacagtgcaggggcc
ctgggcaccctcaggttctgtgtgtttgggctgggctccagagcatacccgcacttctgt
gcctttgctcgagcggtggacacaaggctggaggagctgggcggggagcgactgttgcag
ctgggccagggtgatgagctctgcggccaggaggaggctttccgaggctgggcccaggca
gccttccaggctgcctgtgaaactttctgtgtgggagaagatgccaaggctgctgcccga
gatatcttcagtcccaagcgcagctggaaacgccagaggtaccggctgagtacccaagct
gagagcctgcaattactgccagggctgactcacgtgcacagacggaagatgttccaggct
acaattctttctgtggagaacctacagagcagcaaatccacccgagccacaatcctggtg
cgtctggacactggaagccaggagggactgcagtaccagccaggggaccacataggtgtg
tgcccacccaaccggcctggcctagtggaggcgctgctgagccgagtggaggaccctccg
ccatccacagagcctgtggccgtggaacaactggaaaaaggcagccctggtggccctccc
cccggctgggtacgggacccccggcttcccccatgtacgctgcgccaggctctcacttac
ttcctggacatcacttccccgcccagccctcgccttcttcgactgctgagcaccctggca
gaggagtccagcgaacagcaggagctagaggctcttagccaggacccccggcgctacgaa
gaatggaagtggttccgctgccccacactgctagaggtgctggaacaatttccatccgtg
gcactgcctgccccgctgatcctcacccagctgcccctgctccagccccggtactactct
gtcagctcagcacccagcgcccacccaggagagatccacctcactgtagctgtgctggca
tacagaacccaggatgtgctgggccctctgcactatggggtctgttccacatggatgagc
caactcaaggcaggagacccggtgccctgcttcatcaggggggctccctccttccggctg
ccacctgatcctaacttgccttgcatcctggtgggcccagggactggtattgcacccttc
cggggattctggcaagaccgattacacgacattgagatcaaaggactgcagcctgccccc
atgactttggtgtttggctgccgatgctcccaactggaccatctctaccgggacgaggta
ctggacgcccagcagcgtggagtgtttggacaagtcctcaccgccttttccagggatcct
ggcagccctaagacctatgtgcaagacctcctgaggacagagctggccgcggaggttcac
cgcgtgctgtgcctcgagcaaggacacatgtttgtctgcggtgatgtcactatggcaacc
agcgtcctgcaaaccgtgcagcgaattctggcaacagagggcagcatggagctggatgaa
gccggtgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaggacattttcgga
ctcacattgcgcacccaggaggtgacgagccgcatccgcacccagagtttttctttgcag
gagcgacagctgaggggtgcagtgccctggtcctttgacccgcctacccaagaaacacct
ggttcctga

DBGET integrated database retrieval system