KEGG   Rattus norvegicus (rat): 24602
Entry
24602             CDS       T01003                                 

Gene name
Nppa
Definition
(RefSeq) natriuretic peptides A precursor
  KO
K12334  natriuretic peptide A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04066  HIF-1 signaling pathway
rno04270  Vascular smooth muscle contraction
rno04714  Thermogenesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24602 (Nppa)
   04024 cAMP signaling pathway
    24602 (Nppa)
   04022 cGMP-PKG signaling pathway
    24602 (Nppa)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    24602 (Nppa)
   04921 Oxytocin signaling pathway
    24602 (Nppa)
   04924 Renin secretion
    24602 (Nppa)
   04925 Aldosterone synthesis and secretion
    24602 (Nppa)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24602 (Nppa)
  09159 Environmental adaptation
   04714 Thermogenesis
    24602 (Nppa)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    24602 (Nppa)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 24602
NCBI-ProteinID: NP_036744
RGD: 3193
Ensembl: ENSRNOG00000008176
UniProt: P01161 B0BMW5
Position
5
AA seq 152 aa
MGSFSITKGFFLFLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKMPVEDEVMPPQ
ALSEQTDEAGAALSSLSEVPPWTGEVNPSQRDGGALGRGPWDPSDRSALLKSKLRALLAG
PRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR
NT seq 459 nt   +upstreamnt  +downstreamnt
atgggctccttctccatcaccaagggcttcttcctcttcctggccttttggctcccaggc
catattggagcaaatcccgtatacagtgcggtgtccaacacagatctgatggatttcaag
aacctgctagaccacctggaggagaagatgccggtagaagatgaggtcatgcctccgcag
gccctgagcgagcagaccgatgaagcgggggcggcacttagctccctctctgaggtgcct
ccctggactggggaagtcaacccgtctcagagagatggaggtgctctcgggcgcggcccc
tgggacccctccgatagatctgccctcttgaaaagcaaactgagggctctgctcgctggc
cctcggagcctgcgaaggtcaagctgcttcgggggtaggattgacaggattggagcccag
agcggactaggctgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system