KEGG   Rattus norvegicus (rat): 24603
Entry
24603             CDS       T01003                                 

Gene name
Npr1
Definition
(RefSeq) atrial natriuretic peptide receptor 1 precursor
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04270  Vascular smooth muscle contraction
rno04714  Thermogenesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    24603 (Npr1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24603 (Npr1)
   04022 cGMP-PKG signaling pathway
    24603 (Npr1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    24603 (Npr1)
   04921 Oxytocin signaling pathway
    24603 (Npr1)
   04924 Renin secretion
    24603 (Npr1)
   04925 Aldosterone synthesis and secretion
    24603 (Npr1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24603 (Npr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    24603 (Npr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24603 (Npr1)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     24603 (Npr1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   24603 (Npr1)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA Peripla_BP_6 DUF3958
Other DBs
NCBI-GeneID: 24603
NCBI-ProteinID: NP_036745
RGD: 3195
Ensembl: ENSRNOG00000014684
UniProt: P18910
Structure
PDB: 
1DP4 3A3K 1T34

Position
2
AA seq 1057 aa
MPGSRRVRPRLRALLLLPPLLLLRGGHASDLTVAVVLPLTNTSYPWSWARVGPAVELALA
RVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAP
VGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALV
LYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYI
CSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQ
AFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAV
TETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVL
NYNGTSQELMAVSEHKLYWPLGYPPPDVPKCGFDNEDPACNQDHFSTLEVLALVGSLSLI
SFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGSLL
TTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTD
PPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSS
NCVVDGRFVLKITDYGLESFRDPEPEQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYS
FGIILQEIALRSGVFYVEGLDLSPKEIIERVTRGEQPPFRPSMDLQSHLEELGQLMQRCW
AEDPQERPPFQQIRLALRKFNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRK
AEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDL
YTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHR
PQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVL
EEFDGFELELRGDVEMKGKGKVRTYWLLGERGCSTRG
NT seq 3174 nt   +upstreamnt  +downstreamnt
atgccgggctcccgacgcgtccgtccgcgcctaagggcgctgctgctgctgccgccgctt
ctgctactccggggcggccacgcgagcgacctgaccgtggctgtggtgctgccgctgacc
aacacctcgtacccgtggtcctgggcgcgtgtagggccggccgtggaactggctctcgcg
cgggtgaaggctcggccggacttgctgccgggttggacggtccgcatggtgctgggcagc
agtgagaacgcggcgggcgtctgctcggacaccgccgcaccgctggccgcggtggacctc
aagtgggagcacagccccgcggtgttcctgggccccggctgcgtctactccgctgccccg
gtggggcgcttcaccgcgcactggcgggtgccgctgctgaccgccggcgccccggctctg
ggcatcggggtcaaggatgagtatgcgctaaccacccgcacaggacccagccatgtcaag
ctgggcgatttcgtgacggcgctgcatcgacggctgggctgggagcaccaggcgctggtg
ctctatgcagatcggctgggcgacgaccggccttgcttcttcatagtggaggggctgtac
atgcgggtgcgtgaacgcctcaacatcacagtgaatcaccaggagttcgtcgagggcgac
ccggaccactaccccaagctactgcgggccgtgcggcgaaagggcagagttatctacatc
tgcagttctccggatgccttcaggaatctgatgcttctggccctgaacgctggcctgact
ggggaggactatgttttcttccacctggatgtgtttgggcaaagccttaagagtgctcag
ggccttgttccccagaaaccctgggaaagaggagatgggcaggacaggagtgcccgccag
gcctttcaggctgccaaaattattacttacaaagagcctgataatcctgagtacttggaa
ttcctgaagcagctgaaactcttggctgacaagaagttcaacttcaccgtggaggatggc
ctgaagaatatcatcccagcctccttccacgacgggctcctgctctatgtccaggcagtg
acagagactctggcacaggggggaactgtcacagatggagagaacatcactcagcggatg
tggaaccgaagcttccaaggtgtgacaggatacctgaaaattgatagaaacggagatcgg
gacaccgatttctctctctgggatatggatccagagacgggtgccttcagggttgtcctg
aactataatggtacttcccaggagctaatggctgtgtcagaacacaaattatactggcct
ctgggatatccacctcctgacgtccctaaatgtggctttgacaatgaggacccagcctgc
aaccaagaccacttttccacactggaggttctggctttggtgggcagcctctctctgatt
agctttctgattgtgtctttcttcatatacaggaagatgcagctggaaaaggagctggtc
tcagagttgtggcgggtgcgctgggaggacttgcagcccagcagcctggagaggcatctt
cggagcgctggcagccggctgaccctgagtgggcgaggctccaattatggctccctgcta
accaccgagggccagttccaagtctttgccaagacagcatactataagggcaaccttgtg
gctgtgaaacgtgtgaaccggaaacgcattgagttgacacgaaaagtcctgtttgaactt
aaacatatgcgggatgtgcagaatgagcacttgacaagatttgtgggtgcttgtaccgac
ccccccaacatctgtatcctcacagagtactgtccccgtggaagcctacaggacattcta
gagaatgagagtatcaccctggactggatgtttcggtactcgctcaccaatgacattgtc
aagggaatgctctttctacacaatggggccatttgttcccatgggaacctcaagtcatcc
aactgtgtggtagacgggcgcttcgtgttaaagatcacagactacggtcttgagagcttc
agagacccggagccagagcaaggacacaccctctttgccaaaaaattgtggacggcacct
gagctcctgcgaatggcttcgccacctgcccgtggctcccaagctggggatgtgtacagc
tttggtatcatcctgcaggagattgccctaagaagtggggtcttctatgtggaaggtttg
gacctcagcccaaaagagatcattgagcgtgtgactcggggtgagcagcccccattccga
ccctccatggatctgcagagccacctggaggaactggggcagctgatgcagcggtgctgg
gcagaggacccacaggagcggccaccctttcagcagattcgcctggcgctgcgcaagttc
aacaaggagaacagcagcaacatcctggacaacctgctgtcacgcatggagcagtatgct
aacaacctggaggaactggtagaggagagaacacaagcttatctggaggagaagcgcaaa
gctgaggccttgctttaccagattctgcctcactccgtggctgagcagctgaagagaggc
gagacagtccaggctgaggcctttgatagtgttaccatctacttcagtgatattgtgggc
tttacagctctttcagcagaaagcacacccatgcaggtggtgactctgctcaatgatctg
tacacctgttttgatgctgtcatagacaactttgatgtgtacaaggtggagaccattggt
gatgcttacatggtggtgtcagggctcccagtgcggaatggacaactccacgcccgagag
gtggcccgaatggcacttgcactactggatgctgtgcgctccttccgcatccgccatagg
ccccaggaacagctgcgcttgcgcattggcatccacacaggtcctgtgtgtgctggtgtg
gtagggctaaagatgccccgatactgcctctttggagacacagtcaacacagcttcaaga
atggagtctaatggagaagccctcaagatccacttgtcttcagagaccaaggctgtgctg
gaagagttcgatggtttcgagctggagctccgaggggatgtggaaatgaagggcaaaggc
aaggttcggacctattggctcctgggggagcggggatgtagcactcgaggctga

DBGET integrated database retrieval system