KEGG   Rattus norvegicus (rat): 24609
Entry
24609             CDS       T01003                                 

Gene name
Odc1
Definition
(RefSeq) ornithine decarboxylase
  KO
K01581  ornithine decarboxylase [EC:4.1.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00330  Arginine and proline metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Module
rno_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    24609 (Odc1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24609 (Odc1)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     24609 (Odc1)
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Other DBs
NCBI-GeneID: 24609
NCBI-ProteinID: NP_001289012
RGD: 3227
Ensembl: ENSRNOG00000005424
UniProt: P09057
Position
6
AA seq 461 aa
MGSFTKEEFDCHILDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDVLKKHLRWLKALP
RVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPPERIIYANPCKQVSQI
KYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMGTEVGFSMYLLDIGGGFPG
SEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQ
TGSDDEDESNEQTLMYYVNDGVYGSFNCILYDHAHVKALLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCSLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRSMWQLMKQI
QSHGFPPEVEEQDVGTLPMSCAQESGMDRHPAACASASINV
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgggcagctttactaaggaagagtttgactgccatatcctcgatgaaggtttcactgct
aaggacattctggaccaaaaaatcaatgaagtttcttcctctgatgataaggatgctttc
tatgttgcggacctcggagacgttctaaagaagcatctgaggtggctgaaagctcttccc
cgtgttactcccttctatgctgtcaagtgtaatgacagcagagccatagtgagcaccctg
gctgccattgggacaggatttgattgtgcaagcaagactgaaatacagttggtgcagggg
cttggggtgcctccagagaggattatctatgcaaatccttgtaagcaagtgtctcagatc
aagtatgctgccagtaatggagtccagatgatgacttttgacagtgaaattgagttgatg
aaagttgccagagcacatccaaaggcaaagttggttttgcggattgccactgatgattcc
aaagcagtttgtcggctcagtgttaagtttggtgccacactgaaaaccagcaggcttctc
ttggaacgggcaaaagagctaaatattgatgtcattggtgtcagcttccatgtgggcagt
gggtgtactgaccctgagaccttcgtgcaggcagtgtcagatgcccgctgtgtctttgac
atgggaacagaagttggtttcagcatgtatctgcttgacattggtggtggctttcctggg
tctgaagacacgaagcttaaatttgaggagatcaccagtgtaatcaacccagctctggac
aagtacttcccatcggactctggagtgagaatcatagctgagccaggcagatactacgtc
gcatcagctttcacacttgcagtgaatatcattgccaaaaaaaccgtgtggaaggagcag
accggctcggacgatgaagatgagtcaaacgagcaaactttgatgtattacgtgaatgat
ggagtgtatgggtcatttaactgcattctttatgaccatgcacatgtgaaggccctgctg
cagaagagacccaagccagatgagaagtattactcatccagcatctggggaccaacatgt
gatggccttgatcggatcgtcgagcgctgtagcctgcctgaaatgcatgtgggtgattgg
atgctgtttgagaacatgggtgcatacactgttgctgctgcttctactttcaatgggttc
cagaggccaaacatctactacgtaatgtcacggtcaatgtggcaactcatgaagcaaatc
cagagccatggcttcccgccagaagtggaggagcaggatgttggcactctgcccatgtct
tgtgcccaggagagcgggatggaccgtcaccctgcagcctgtgcttctgctagtatcaat
gtatag

KEGG   Rattus norvegicus (rat): 297899
Entry
297899            CDS       T01003                                 

Gene name
RGD1562036
Definition
(RefSeq) antizyme inhibitor 2
  KO
K01581  ornithine decarboxylase [EC:4.1.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00330  Arginine and proline metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Module
rno_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    297899 (RGD1562036)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    297899 (RGD1562036)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     297899 (RGD1562036)
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Other DBs
NCBI-GeneID: 297899
NCBI-ProteinID: XP_232777
RGD: 1562036
Ensembl: ENSRNOG00000024788
UniProt: F1LVE6
Position
5
AA seq 457 aa
MRGTEERGWVHKTVLSMMPELCMANISTRVSGMTTPSEGRREPLGVTESLWPSEPITLGP
ETSARQLVLKKIQDLSISGHQDPFMVADLDVLASRHQTFLQALPRVWPFYAVKCNNRPSL
LLVLAALGTGFDCASQGELEQVLGLGVAPSRIIFANPCKAVSHIQYAARCGVQLLTFDSE
EELTKLARHHPGARLILRIQTLGGRSTFPLHTKFGARLLACGRLLQVARELGLAVVGASF
HVGSDCHTPQSYRQAIADCHRVFEMGCKAGHQMSLLDLGGGFPGIEGSEAKFEEMARVVN
AALAQYFPEGTGVEVIAEPGRFYAESVCTAAVNIIAKKASLEPGGHRKLAYYLNEGHYGA
FRIFLRDPVPRIPIVVKELPSDPHLFPCTLYGPTCDAFDRLFSTEVQLPELDVGDWLVFP
DMGAYRSTMSSTFNGFPITTVYDAMSPQLRSLLETVP
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcgagggacggaagaaagaggctgggtccacaaaactgtcctttctatgatgccagaa
ctgtgcatggcaaacatctcaactagagtctcagggatgaccaccccctctgagggtagg
agggagccgctgggagtcacagaaagcctgtggccatcagagcccatcaccctggggccg
gagacatctgcccggcagctggtcctgaagaagatccaggacttgtccatctcgggccac
caagaccccttcatggtggctgacttggatgtgctggccagccgacatcagaccttcctc
caggccctgccccgagtctggcccttctacgcggtcaagtgtaacaataggcccagcctg
ctgctcgttttggctgccctgggcaccggctttgactgtgccagccagggggagctggag
caggtgctgggcttgggcgtggccccctcacgaatcatcttcgccaatccctgcaaggcc
gtctcccacatccagtacgcagcccgctgtggggtgcagcttctgacctttgacagtgag
gaggagctgactaagctggcccggcaccaccctggggctaggttgatcctccggatacag
accctgggtggtcgaagcaccttcccactgcacaccaagttcggagcccgtttgttggca
tgtggacgcctgctccaagttgccagagagctggggttggctgtggtgggggcctccttc
cacgtgggttccgactgccacacaccccagagctacaggcaggccatcgctgactgccat
cgtgtgtttgagatgggctgcaaggctggccaccaaatgagcctcctggatcttggtggg
ggcttcccaggaattgagggctctgaagccaaattcgaggagatggcgagagtggtcaac
gctgccctggcacagtacttccctgaggggaccggtgtcgaggtcattgcggagcctggc
cgcttctatgcagagtccgtgtgtacagctgccgtgaacatcatagccaagaaggcctcc
ctggagccaggaggccacaggaagctggcatactacctcaatgagggccattatggtgcc
ttccgaatctttctcagggatcctgtccccaggatacccatagtggtaaaggagttaccc
tcggatccccatctcttcccctgtactctttatggccccacctgcgatgcctttgaccgg
ctcttttcaacagaggttcagttgccagagctggatgtgggtgactggctggttttccct
gacatgggtgcctaccgtagcaccatgagttccaccttcaatggcttcccaatcacaact
gtctatgatgccatgagccctcaactcaggagcctactggagacagtaccttaa

DBGET integrated database retrieval system