KEGG   Rattus norvegicus (rat): 246097
Entry
246097            CDS       T01003                                 

Gene name
Fas
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 precursor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04217  Necroptosis
rno04650  Natural killer cell mediated cytotoxicity
rno04668  TNF signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno04940  Type I diabetes mellitus
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    246097 (Fas)
   04668 TNF signaling pathway
    246097 (Fas)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    246097 (Fas)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    246097 (Fas)
   04217 Necroptosis
    246097 (Fas)
   04115 p53 signaling pathway
    246097 (Fas)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    246097 (Fas)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    246097 (Fas)
   05205 Proteoglycans in cancer
    246097 (Fas)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    246097 (Fas)
   05161 Hepatitis B
    246097 (Fas)
   05160 Hepatitis C
    246097 (Fas)
   05164 Influenza A
    246097 (Fas)
   05162 Measles
    246097 (Fas)
   05168 Herpes simplex virus 1 infection
    246097 (Fas)
   05163 Human cytomegalovirus infection
    246097 (Fas)
   05167 Kaposi sarcoma-associated herpesvirus infection
    246097 (Fas)
   05169 Epstein-Barr virus infection
    246097 (Fas)
   05165 Human papillomavirus infection
    246097 (Fas)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    246097 (Fas)
   05143 African trypanosomiasis
    246097 (Fas)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    246097 (Fas)
   05330 Allograft rejection
    246097 (Fas)
   05332 Graft-versus-host disease
    246097 (Fas)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    246097 (Fas)
   05022 Pathways of neurodegeneration - multiple diseases
    246097 (Fas)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    246097 (Fas)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    246097 (Fas)
   04932 Non-alcoholic fatty liver disease
    246097 (Fas)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    246097 (Fas)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    246097 (Fas)
   04090 CD molecules [BR:rno04090]
    246097 (Fas)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   246097 (Fas)
CD molecules [BR:rno04090]
 Proteins
  246097 (Fas)
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 246097
NCBI-ProteinID: NP_631933
RGD: 619831
Ensembl: ENSRNOG00000019142
UniProt: Q63199 F1LWQ2
Position
1
AA seq 324 aa
MLWIMAVLPLVLAGPELNVRMQGTDSISEGLELKRSVRETDNNCSEGLYQVGPFCCQPCQ
PGERKVKDCTTSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQN
TKCRCKENFYCNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYKLLWLLILPGL
AILFVFIYKRYRKRQPGDPESGIPSPESVPMNVSDVNLNKYIWRTAEKMKICDAKKFARQ
HKIPESKIDEIEHNSPQDAAEQKIQLLQCWYQSHGKTGACQALIQGLRKANRCDIAEEIQ
AMVWEDHENSISNSRNENEGQSLE
NT seq 975 nt   +upstreamnt  +downstreamnt
atgctgtggatcatggctgtcctgcctctggtgcttgctggccccgagttaaatgttcga
atgcaagggactgatagcatctctgagggtttggagttgaagaggagcgttcgtgaaacc
gacaacaactgctcagaagggttatatcaagtgggcccattttgctgtcaaccgtgtcag
cctggtgaacgaaaagttaaggactgcacaacaagtggaggtgcaccaacctgccatccg
tgcacagaaggggaggagtacacggacaggaaacactattctgataaatgcagaaggtgc
gccttctgtgatgaagggcatggtttagaagtggaaacgaactgcacccggacccagaat
accaagtgcaggtgcaaagaaaacttctattgcaatgcttctctctgtgaccactgttat
cactgcacctcgtgtggacttgaagacatccttgagccttgcacacgaaccagcaacacc
aaatgcaagaaacaaagttccaattataagctcctttggctgctgatcctccccggtttg
gcaattctatttgtgttcatatataaaaggtaccggaagaggcaacctggtgaccctgaa
tctggaatcccaagtcctgaaagtgtgccaatgaatgtctcagatgttaacttgaataaa
tacatctggagaactgccgaaaaaatgaaaatctgtgacgctaaaaaatttgctcggcag
cacaagatcccggaaagcaagatcgatgagatcgagcacaacagcccccaagatgcagct
gagcagaaaatccagctgctccagtgctggtatcaatctcacgggaagactggtgcgtgt
caagctttaatccagggtctcagaaaagctaaccgctgcgacatcgcagaggaaattcaa
gccatggtctgggaggaccatgaaaactcaatctcaaacagcagaaatgaaaatgaagga
caaagtctggagtga

DBGET integrated database retrieval system