KEGG   Rattus norvegicus (rat): 246118
Entry
246118            CDS       T01003                                 

Gene name
Tubb3
Definition
(RefSeq) tubulin, beta 3 class III
  KO
K07375  tubulin beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04540  Gap junction
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    246118 (Tubb3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    246118 (Tubb3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    246118 (Tubb3)
   05012 Parkinson disease
    246118 (Tubb3)
   05014 Amyotrophic lateral sclerosis
    246118 (Tubb3)
   05016 Huntington disease
    246118 (Tubb3)
   05020 Prion disease
    246118 (Tubb3)
   05022 Pathways of neurodegeneration - multiple diseases
    246118 (Tubb3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    246118 (Tubb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    246118 (Tubb3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    246118 (Tubb3)
   04147 Exosome [BR:rno04147]
    246118 (Tubb3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     246118 (Tubb3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    246118 (Tubb3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   246118 (Tubb3)
  Exosomal proteins of colorectal cancer cells
   246118 (Tubb3)
  Exosomal proteins of bladder cancer cells
   246118 (Tubb3)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 246118
NCBI-ProteinID: NP_640347
RGD: 628595
Ensembl: ENSRNOG00000017209
Vega: OTTRNOG00000002194
UniProt: Q4QRB4
Position
19q12
AA seq 450 aa
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYV
PRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRG
LKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEMYEDDDEESEAQGPK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgagggagatcgtgcacatccaggccggccagtgcggcaaccagataggggccaagttc
tgggaggtcatcagtgacgagcatggcatagaccccagcggcaactatgtgggggactcg
gacctgcagctggaacgcatcagtgtctactacaatgaggcctcctctcacaagtatgtg
cccagagccattctggtggacctggagcctggaaccatggacagcgttcggtctggggcc
tttggacacctattcaggcctgacaactttatcttcggtcagagtggtgctggcaacaac
tgggccaaagggcactatacagagggcgccgagctggtggactcagtcctggatgtcgtg
aggaaagaatgtgagaattgtgactgcctgcagggcttccagctcactcactcactgggt
gggggcacgggctcaggcatgggcacactgctcatcagcaaagtgcgtgaggagtaccct
gaccgcatcatgaacaccttcagcgtggtgccctcacccaaagtgtcagacaccgtggta
gagccctacaacgccaccctgtccatccaccagctagtggagaacacggatgagacctac
tgcatcgacaatgaagccctctacgacatctgcttccgcaccctcaagctggctacaccc
acctacggggacctcaaccaccttgtgtctgctaccatgagcggagtcaccacctccctt
cgattccctggtcagctcaatgccgacctccgcaagctagctgtcaacatggtgcccttc
ccccgcttgcatttcttcatgcccggctttgccccactaacagcccggggcagccaacag
taccgtgccctgacggtgcctgagctcacccagcagatgttcgacgccaagaacatgatg
gctgcctgtgacccacgccacggccgctacctgaccgtggccaccgtcttccgtgggcgc
atgtccatgaaggaggtggatgagcagatgctggccattcagagtaagaacagtagttac
ttcgtggagtggatccccaacaacgtcaaggtagcggtgtgtgacatcccgccccgaggg
ctcaagatgtcgtccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagtttacggccatgttccggcgcaaggccttcctccactggtacacgggc
gaaggcatggatgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtct
gagtaccagcagtaccaggacgccactgccgaggaggagggggagatgtatgaagatgac
gacgaggagtcggaagcccaggggcccaagtga

DBGET integrated database retrieval system