KEGG   Rattus norvegicus (rat): 246120
Entry
246120            CDS       T01003                                 

Symbol
Plbd2
Name
(RefSeq) putative phospholipase B-like 2 precursor
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Phospholip_B
Other DBs
NCBI-GeneID: 246120
NCBI-ProteinID: NP_640348
RGD: 708461
Ensembl: ENSRNOG00000001385
UniProt: Q4QQW8
Position
12
AA seq 585 aa
MAAPMDRTHGGRAARALRRALALASLAGLLLSGLAGALPTLGPGWRRQNPEPPASRTRSL
LLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEAS
VSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRL
TLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSC
SALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAGNNLIFSSYPG
TIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNIVANRLALDGATWAD
VFRRFNSGTYNNQWMIVDYKAFIPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWA
SYNIPYFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDF
LHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYM
SMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPWD
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggcggcccccatggaccggacccatggtggccgggcggcccgggcgctgcggcgggct
ctggcgctggcctcgctggccgggctattgctgagcggcctggcgggtgctctccccacc
ctcgggcccggctggcggcgccaaaaccccgagccgccggcctcccgcacccgctcgctg
ctgctggacgccgcttcgggccagctgcgcctggagtacggcttccaccccgatgcggtg
gcctgggctaacctcaccaacgccatccgcgagactgggtgggcctatctggacctgggc
acaaatggcagctacaatgacagcctgcaggcctatgcagctggtgtggtggaggcctct
gtgtccgaggagctcatctacatgcactggatgaacacggtggtcaattactgcggcccc
ttcgagtacgaagtcggctactgtgagaagctcaagagcttcctggaggccaacctggag
tggatgcagagggaaatggagcttagcccggactcgccatactggcaccaggtgcggctg
accctcctgcagctgaaaggcctggaggacagctatgaaggccgtttaaccttcccaact
gggaggttcaacatcaaacccttggggttcctcctgctgcagatctctggagatctggaa
gacctagagccagccctgaataagaccaacaccaagccttccgtgggctccggttcgtgc
tctgccctcatcaagctgctgcccggcagccatgatctcctggtggctcacaacacttgg
aactcctaccagaacatgttacgcatcatcaagaagtaccggctgcagttccgggagggg
ccgcaagaggagtaccccctgattgccggcaacaacttgattttttcgtcttacccgggc
accatcttctccggtgatgacttctacatcctgggcagtgggctggtcaccctggagacc
accatcggcaacaagaacccagcgctgtggaagtacgtgcaaccccagggctgtgtgctg
gagtggattcgaaacattgtggccaaccgcctggccttggatggggccacctgggcagat
gtcttcaggcggttcaatagtggcacgtataataaccagtggatgattgtggactacaag
gcattcatccccaatgggcccagccctggaagccgggtgctcaccatcctagaacagatc
ccgggcatggtggtggtggcggacaagactgcagagctctacaagacgacctactgggct
agctacaacatcccgtactttgagagtgttttcaacgctagtggtctgcaggccctggta
gcccagtacggagattggttctcctacaccaggaaccctcgagccaagatcttccagagg
gaccagtcactagtggaggacgtagacaccatggtccggctcatgaggtacaatgacttc
cttcatgaccctctgtcgttgtgtgaggcctgcagcccgaagcccaacgcagagaacgcc
atctctgcccgctctgatctcaaccctgctaatggctcctacccatttcaggccctgcgt
cagcgcgcccatggcggcattgatgtgaaggtgaccagcgttgcactggctaagtacatg
agcatgctggcagccagtggccccacgtgggaccagttgccaccgttccagtggagtaaa
tcaccattccacaacatgctgcacatgggccagcctgatctttggatgttctcacctgtc
aaggtcccatgggactga

DBGET integrated database retrieval system