KEGG   Rattus norvegicus (rat): 24613Help
Entry
24613             CDS       T01003                                 

Gene name
Oprd1
Definition
(RefSeq) opioid receptor, delta 1
  KO
K04213  delta-type opioid receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    24613 (Oprd1)
   04022 cGMP-PKG signaling pathway
    24613 (Oprd1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24613 (Oprd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24613 (Oprd1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Opioid
    24613 (Oprd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 24613
NCBI-ProteinID: NP_036749
RGD: 3233
Ensembl: ENSRNOG00000010531
UniProt: P33533
Position
5q36
AA seq 372 aa AA seqDB search
MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggagccggtgccttctgcccgtgcggagctgcagttttcgctcctcgccaacgtctcg
gacaccttccctagcgccttccccagtgcgagcgccaatgcgtcggggtcgccgggcgcc
cgcagtgcctcgtccctggctctggccatcgccatcaccgcgctctactcggctgtgtgc
gccgtggggctgctgggcaacgtgctcgtcatgtttggaatcgtccggtacactaagctg
aagacggccaccaacatctacatcttcaatctggccttggcggatgcgctggccaccagc
acactgcccttccagagcgccaagtacctgatggaaacgtggccgttcggagagctgctg
tgcaaggctgtgctctccattgactactacaacatgttcaccagcatcttcacgctcacc
atgatgagcgtggaccgctacattgcggtctgccaccctgtcaaggccttggacttccgg
acaccggccaaggccaagctgatcaacatatgcatctgggtcttggcttcaggtgttggg
gtccccatcatggtcatggcagtgacccaaccccgggatggagcagtggtatgcacgctc
cagttccccagccccagctggtactgggacactgtgaccaagatctgcgtgttcctcttc
gccttcgtggtgcccattctcatcatcaccgtgtgctatggcctcatgctgctgcgcctg
cgcagcgtgcgcctgctgtccggctccaaggagaaggaccgcagcctgcggcgcatcacg
cgcatggtgctggtggtggtgggagccttcgtggtgtgctgggcgcccatccacatcttc
gtcatcgtctggacgctggtggacatcaatcggcgcgacccacttgtggtggccgcgctg
cacttgtgcattgcgctgggctacgccaacagcagcctcaacccggttctctacgccttc
ctggacgagaacttcaagcgctgcttccgccagctctgtcgcgcgccctgcggcggccaa
gaacccggcagcctccgccgtccccgccaggccaccgcgcgtgagcgtgtcaccgcctgc
accccctccgacggcccgggcggtggcgctgccgcctga

DBGET integrated database retrieval system