KEGG   Rattus norvegicus (rat): 246136
Entry
246136            CDS       T01003                                 

Gene name
Man2c1
Definition
(RefSeq) mannosidase, alpha, class 2C, member 1
  KO
K01191  alpha-mannosidase [EC:3.2.1.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    246136 (Man2c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    246136 (Man2c1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     246136 (Man2c1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    246136 (Man2c1)
SSDB
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2
Other DBs
NCBI-GeneID: 246136
NCBI-ProteinID: NP_640349
RGD: 628787
Ensembl: ENSRNOG00000030654
UniProt: P21139
Position
8q24
AA seq 1040 aa
MAAAPFLKHWRTTFERVEKFVSPIYFTDCNLRGRLFGDSCPVTLSSFLTPERLPYEKAVQ
QNFSPAQVGDSFGPTWWTCWFRVELVIPEVWVGKEVHLCWESDGESLVWRDGEPVQGLTK
EGEKTSYVLSERLHAADPRSLTLYVEVACNGLLGAGKGSMIAAPDPEKMFQLSQAKLAVF
HRDVHNLLVDLELLLGVAKGLGEDNQRSFQALYTANQMVNICDPAQPETYPAAEALASKF
FGQRGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWSTAVKLMERNTEFTFACSQAQ
QLEWVKNQYPGLYAQLQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQEF
GKMCSEFWLPDTFGYSAQLPQIMQGCGIKRFLTQKLSWNLVNSFPHHTFFWEGLDGSQVL
VHFPPGDSYGMQGSVEEVLKTVTNNRDKGRTNHSGFLFGFGDGGGGPTQTMLDRLKRLGN
TDGQPRVQLSSPGQLFTALERDSGQLCTWVGELFLELHNGTYTTHAQLKKGNRECEQILH
DVELLSSLALARSAQFLYPAVQLQRLWRLLLLNQFHDVVTGSCIQLVAEDAMNYYEDIRS
HGNTLLSAAAAALCAGEPGPKGLRHYQHTALEAHRSVGTTQGLVGLTRLALVTVPSIGYA
PAPTPTSLQPLLPQQPVFVMQETDGSVTLDNGIIRVRLDPTGCLTSLVLVASGREAIAEG
ALGNQFVLFDDVPLYWDAWDVMDYHLETRKPVRGQAGTLAVGAEGGLRGSAWFLLQISPN
SRLSQEVVLDVGCPYVRFHTEVHWHETHKFLKVEFPARVRSPQATYEIQFGHLQEADPQQ
HSWDWARYEVWAHRWIDLSECDFGLALLNNCKYGTSVRGNVLSLSLLRAPKAPDVTADMG
RHEFTYALMPHKGSFQEAGVIQAAYNLNFPLLALPAPGPAPDTTWSAFSVSSPAVVLETI
KQAEKSHQHRTLVLRLYEAHGSHVDCWLHTSLPVQEATLCDLLEQRDPTGHLSLQDNRLK
LTFSPFQVRSLLLVLQPPAN
NT seq 3123 nt   +upstreamnt  +downstreamnt
atggcggcagcgccgttcttgaagcactggcgcaccacttttgagcgggtggagaagttc
gtgtccccgatctacttcaccgactgtaaccttcgcggcaggctcttcggggacagctgc
ccggtgacactctccagcttcctgacgccggaaaggcttccctatgagaaggcagtgcag
cagaacttcagccctgcgcaggtcggcgacagcttcggacccacatggtggacctgctgg
tttcgggtagaactggtcatccctgaagtttgggtgggcaaggaagttcatctttgctgg
gaaagtgatggagaaagccttgtctggcgtgatggggaacctgtccagggtttgaccaag
gagggtgaaaagactagttatgtcctgagtgagaggctgcacgcagcagatcctcggagc
ttgactctctatgtggaagtagcctgcaatgggcttctgggagccgggaagggaagcatg
atcgcagcccctgaccctgagaagatgttccagctgagccaggctaagctggctgtgttc
caccgggatgtccacaatctcctggtggacctggagctgttgctgggtgtggccaagggc
ctcggggaggacaaccagcgcagcttccaggccctgtacacagccaaccagatggtgaac
atatgtgaccctgcgcagcctgagacttacccagcagccgaggccctggcctccaagttc
tttggccaacgtggaggtgaaagccagcataccatccatgcaacaggacactgtcacatt
gatacagcctggctttggcccttcaaggagactgtgaggaaatgtgcccggagctggtca
acagctgtgaagctcatggagcggaacactgagttcacctttgcctgctctcaggcacaa
cagctcgagtgggtaaagaaccaataccctggtctgtatgcccagctccaggagtttgcc
tgccgaggacagtttgtgcctgtggggggcacctgggtagaaatggatgggaaccttccc
agtggagaggccatggtgaggcagttcctacagggccagaacttctttctgcaagagttt
ggaaagatgtgctctgagttctggctgccagatacatttggctactcagcacagctcccc
cagatcatgcaaggctgtggcatcaaacgcttcctgacacagaaactgagctggaacttg
gtcaactccttcccacaccataccttcttctgggaggggctggatggctcccaagtgctg
gtacacttcccccctggagactcatatggaatgcagggcagtgtggaagaggtgctgaag
actgtgaccaacaaccgggacaagggacggaccaaccacagtggcttcctctttggcttc
ggggatgggggtggtggccccacacagaccatgttggaccgattgaagcggctgggcaac
actgatgggcagcccagggtgcagctgtcttctcctggacagctcttcacagcactggag
agagactcagggcagctgtgcacatgggttggggaactcttcttggagctgcacaatggc
acctatactacccatgcccagctcaagaaggggaaccgagaatgtgagcagattcttcat
gacgtggagctgctcagcagccttgccctagcccgaagtgcccagttcctgtacccggca
gtccagctgcagcgcctctggaggctcctactcctcaaccagttccatgatgtggtgact
ggaagctgcattcagctggtggcagaagatgccatgaactactatgaagacatccgttct
catggcaatacgctgctcagtgctgcagccgcagccttgtgtgctggggagccaggtccc
aagggcctccgtcattatcaacacactgccctggaagcgcacagaagtgttggcactacc
caaggccttgtggggctcacacgcctagccctggtgacagtgcccagtattggctatgct
cctgctcccacccctacttcactgcagcccctcctaccccagcagcccgtgtttgtgatg
caggagactgacggttccgtgacgctggacaatggcatcatccgggtgagactggatcca
actggctgtcttacttccctggtcctggtggcttctggcagggaagccattgctgagggt
gccctggggaatcagtttgtgctgtttgatgatgtgccactgtactgggatgcatgggac
gtcatggactaccatctagagacacggaagcctgtgcggggccaggcaggtaccctggca
gtaggcgctgaaggtggccttcggggtagtgcctggttcctgctacagatcagccccaac
agtcggctcagccaggaagtcgtgctggatgttggttgcccctatgtccgcttccacacg
gaggtgcactggcacgagacccacaagttcctgaaggtggagttcccagctcgagtacgg
agcccccaggctacctatgagatccagtttgggcaccttcaggaggccgacccacaacaa
cactcctgggactgggctcgctatgaggtgtgggctcatcgctggatagatctgtccgag
tgtgactttgggctggccctgctcaacaactgcaagtatggaacgtcagtacgaggcaac
gtcctcagcctctcactgctgcgtgcacccaaggctccagatgttactgctgacatgggg
cgccatgaattcacttatgccttgatgccacacaagggttctttccaagaagctggtgtt
atccaggctgcctacaacctcaactttcccctcttggcactgccagctccaggcccagcc
cctgataccacctggagcgccttttccgtgtcttcaccagcagtcgtgttggagaccatc
aagcaggccgagaagagccatcagcaccgcacactggttctaaggctgtatgaggctcat
ggcagccatgtggactgctggctacacacatcattgcctgttcaggaggccaccctttgt
gacctcctggagcagcgagaccctaccggtcacctgtcccttcaggacaaccgcctgaag
ctcaccttttctccctttcaagtgaggtccttattgcttgtgcttcagcctccagcaaac
tga

DBGET integrated database retrieval system