KEGG   Rattus norvegicus (rat): 24614
Entry
24614             CDS       T01003                                 

Gene name
Orm1, AGP, Agpa1, OMD, Orm
Definition
(RefSeq) orosomucoid 1
  KO
K17308  alpha-1-acid glycoprotein
Organism
rno  Rattus norvegicus (rat)
Brite
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   24614 (Orm1)
SSDB
Motif
Pfam: Lipocalin Virulence_fact
Other DBs
NCBI-GeneID: 24614
NCBI-ProteinID: NP_445740
RGD: 67390
Ensembl: ENSRNOG00000007886
UniProt: P02764
Position
5q24
AA seq 205 aa
MALHMVLVVLSLLPLLEAQNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAV
QTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHL
IVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTK
DKCSEQQKQQLELEKETKKETKKDP
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcgctgcacatggttcttgtcgttttgagcctcctgcccttgttggaagctcagaac
ccagaacctgccaacatcaccctaggcatacctattaccaatgagaccctgaaatggctc
tcagacaaatggttttacatgggagcagctttccgagaccccgtgttcaagcaggcagtt
caaacgatacagacggaatatttttaccttacccccaacttgataaacgacacaattgaa
cttcgggagtttcagaccacagacgaccagtgtgtctataacttcacccatctaggagtc
cagagagagaatgggaccttatccaagtgtgcaggagcagtgaaaatctttgcccatttg
atagtgctgaagaaacatgggaccttcatgcttgcctttaacctgacagatgagaaccgg
gggctgtccttctatgctaaaaagccagacttgtccccagagctgcggaaaatattccag
caggctgtcaaagatgtgggcatggatgaatcagaaatcgtatttgtcgactggacaaag
gataagtgcagtgagcagcagaagcagcagctggagctggagaaggagactaagaaggag
accaagaaggatccttag

DBGET integrated database retrieval system