KEGG   Rattus norvegicus (rat): 246142Help
Entry
246142            CDS       T01003                                 

Gene name
Bmf
Definition
(RefSeq) Bcl2 modifying factor
  KO
K17460  Bcl-2-modifying factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    246142 (Bmf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BMF
Motif
Other DBs
NCBI-GeneID: 246142
NCBI-ProteinID: NP_640351
RGD: 628658
Ensembl: ENSRNOG00000007529
UniProt: Q8K589
Position
3q35
AA seq 185 aa AA seqDB search
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGL
RPVSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSALGEQP
PEGQFLQHRAEVQIARKLQCIADQFHRLHMQQHQQNRDRAWRQVFLFLQNLALNRRENRE
GVGPW
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggagccacctcagtgtgtggaggaactagaagatgatgtgttccagccagaggatggg
gagccagggacacagcctgggagcttgctctctgctgacctgtttgcccagagccagctg
gattgtcccctcagtcggcttcagctcttcccgcttacccactgctgtggtcctgggctc
cggcctgtaagccaggaagacaaggccacccagaccctcagcccagcctccccaagccag
ggtgtcatgctgccttgtggggtgacagaggaaccccagagactcttttacggcaacgct
ggctacaggcttcctctccctgccagtttccccgcaggctcagcccttggggagcagccc
cctgaaggacagttccttcagcaccgagcagaggtacagatcgccagaaagcttcagtgc
attgcagaccagttccatcggcttcatatgcaacaacaccagcagaaccgagaccgagca
tggcggcaggtcttcctcttccttcaaaacctggccttgaacagacgagaaaacagggaa
ggggtgggtccctggtga

DBGET integrated database retrieval system