KEGG   Rattus norvegicus (rat): 24617
Entry
24617             CDS       T01003                                 

Gene name
Serpine1, PAI1A, Pai1, Pai1aa, Planh, RATPAI1A
Definition
(RefSeq) serpin family E member 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno04371  Apelin signaling pathway
rno04390  Hippo signaling pathway
rno04610  Complement and coagulation cascades
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    24617 (Serpine1)
   04371 Apelin signaling pathway
    24617 (Serpine1)
   04066 HIF-1 signaling pathway
    24617 (Serpine1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    24617 (Serpine1)
   04218 Cellular senescence
    24617 (Serpine1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24617 (Serpine1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24617 (Serpine1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    24617 (Serpine1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24617 (Serpine1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24617 (Serpine1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24617 (Serpine1)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   24617 (Serpine1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24617 (Serpine1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   24617 (Serpine1)
SSDB
Motif
Pfam: Serpin Rax2
Other DBs
NCBI-GeneID: 24617
NCBI-ProteinID: NP_036752
RGD: 3249
Ensembl: ENSRNOG00000001414
UniProt: P20961
Position
12q12
AA seq 402 aa
MQMSSALTCLTLGLVLVFGKGFASPLPESHTAQQATNFGVKVFQHVVQASKDRNVVFSPY
GVSSVLAMLQLTTAGKTRQQIQDAMGFNISERGTAPALRKLSKELMGSWNKNEISTADAI
FVQRDLELVQGFMPHFFKLFRTTVKQVDFSEVERARFIINDWVERHTKGMISDLLAKGAV
NELTRLVLVNALYFNGQWKTPFLEASTHQRLFHKSDGSTISVPMMAQNNKFNYTEFTTPD
GHEYDILELPYHGETLSMFIAAPFEKDVPLSAITNILDAELIRQWKSNMTRLPRLLILPK
FSLETEVDLRGPLEKLGMTDIFSSTQADFTSLSDQEQLSVAQALQKVKIEVNESGTVASS
STAILVSARMAPTEMVLDRSFLFVVRHNPTETILFMGQLMEP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgcagatgtcttcagccctcacttgcctcaccctgggcctggttctggtctttgggaaa
gggttcgcttcaccccttccagagtcccatacagcccagcaggccaccaacttcggagta
aaagtgtttcagcatgtggtccaggcctccaaagaccgaaatgtggtcttctctccctac
ggcgtgtcctcggtgctggctatgctgcagctgaccacagcagggaaaacccggcagcag
atccaagatgctatgggattcaatatcagtgagaggggcacagctcctgccctccgaaag
ctctccaaggagctcatggggtcatggaacaagaatgagatcagtactgcggacgccatc
tttgtccagcgggacctagagctggtccagggcttcatgccccacttcttcaagctcttc
cggaccacggtgaagcaggtggacttctcagaggtggaaagagccagattcatcatcaac
gactgggtggagaggcacaccaaaggtatgatcagtgacttactggccaagggggctgta
aatgagctgacacgcctggtgctggtgaacgccctctatttcaacggccaatggaagacc
cccttcttagaggccagcacccaccagcgcctgttccacaagtctgatggtagcaccatc
tccgtgcccatgatggctcagaacaacaagttcaactacactgagttcaccactccggat
gggcacgagtacgacatcctggaactgccctaccacggcgaaaccctcagcatgttcatt
gcagcaccctttgaaaaagatgtgcccctctccgccatcaccaacattttggacgctgag
ctcatcagacaatggaagagcaacatgaccaggctgccccgcctcctcatcctgcctaag
ttctctctggagactgaagtggacctcagagggcccctggagaagctgggcatgactgac
atcttcagctcaacccaggccgacttcacaagtctttccgaccaagagcagctctctgta
gcacaagcactacaaaaggtcaagatcgaggtgaacgagagcggcacagtggcgtcttcc
tccacagccattctagtctcagcccgcatggcccccacggagatggttttagaccgatcc
tttctctttgtggttcggcacaatccaacagagacaatcctcttcatgggccagctgatg
gagccttga

DBGET integrated database retrieval system