KEGG   Rattus norvegicus (rat): 24618
Entry
24618             CDS       T01003                                 

Gene name
Reg3b, Pap, Pap1
Definition
(RefSeq) regenerating family member 3 beta
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 24618
NCBI-ProteinID: NP_445741
RGD: 3254
Ensembl: ENSRNOG00000006151
UniProt: P25031 A0A0H2UHE4
Position
4q33
AA seq 180 aa
MMRVKMLHRLAFPVMSWMLLSCLMLLSQVQGEDSPKKIPSARISCPKGSQAYGSYCYALF
QIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEP
NGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
NT seq 543 nt   +upstreamnt  +downstreamnt
atgatgagagttaagatgttgcatcgcttggccttcccagtcatgtcctggatgctgctc
tcctgcctgatgctcttatcacaggtgcaaggagaagactctccgaagaaaataccctct
gcacgcattagttgccccaaaggctcccaggcatatggctcctactgctatgccctgttt
cagataccacagacctggtttgatgcagaactggcctgccagaagagacctgaaggacac
cttgtatctgtgctcaatgtagctgaagcttcattcttggcatccatggtcaagaacact
ggaaacagctaccaatatacctggattggactccatgaccccactcttggtggagaaccc
aatggaggtggatgggagtggagtaacaatgacataatgaattatgtcaactgggagagg
aacccatctactgccttagaccgcggattctgtggcagcttgtcaagatcttctggattt
ctaagatggagagataccacatgtgaagtgaagttgccctacgtctgcaaatttacaggt
taa

DBGET integrated database retrieval system