KEGG   Rattus norvegicus (rat): 246212
Entry
246212            CDS       T01003                                 

Gene name
Sipa1l1
Definition
(RefSeq) signal-induced proliferation-associated 1-like protein 1 isoform 1
  KO
K17701  signal-induced proliferation-associated 1 like protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    246212 (Sipa1l1)
SSDB
Motif
Pfam: SPAR_C Rap_GAP PDZ PDZ_6 DUF4164 Rootletin ATG16 Sec34 YabA ZapB RasGAP_C
Other DBs
NCBI-GeneID: 246212
NCBI-ProteinID: NP_647546
RGD: 708497
Ensembl: ENSRNOG00000007646
UniProt: O35412
Position
6
AA seq 1783 aa
MTSLKRSQTERPVTADRASVVSTDGTPKVHTDDFYMRRFRSQNGSLGSSVMAAVGPPRSE
GPHHITSTPGVPKMGVRARIADWPPRKENVKESSRSSQEIETSSCLESLSSKGSPVSQGS
SVSLNSNDSAMLKSIQNTLKNKTGPAESMDSRFLMPEAYPSSPRKALRRIRQRSNSDITI
SELDVDSFDECISPTYKSGPSLHREYGSTSSIDKQGTSGESFFGLLKGYKDDRADRGPTP
TKLSDFLITGGGKGSGFSLDVIDGPISQRENLRLFKEREKPLKRRSKSETGDSSIFRKLR
NAKGEELGKSSDLEDNRSEDSVRPWTCPKCFAHYDVQSILFDLNEAIMNRHNVIKRRNTT
TGASAAAVASLVSGPLSHSASFSSPMGSTEDLNSKGSLGMDQGDDKSNELVMSCPYFRNE
IGGEGERKISLSKSNSGSFSGCESTSFESALSSHCTNAGVAVLEVPKESLMLHLDRVRRY
TVEHVDLGAYYYRKCFYQKEHWNYFGADENLGPVAVSIRREKPEDMKENGSPYNYRIIFR
TSELMTLRGSVLEDAIPSTAKHSTARGLPLKEVLEHVIPELNVQCLRLAFNTPKVTEQLM
KLDEQGLNYQQKVGIMYCKAGQSTEEEMYNNESAGPAFEEFLQLLGERVRLKGFEKYRAQ
LDTKTDSTGTHSLYTTYKDYEIMFHVSTMLPYTPNNKQQLLRKRHIGNDIVTIVFQEPGA
QPFSPKNIRSHFQHVFVIVRAHNPCTESVCYSVAVTRSRDVPSFGPPIPKGVTFPKSNVF
RDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAEKNVTNTPIDPSGKFPFISLASK
KKEKSKPYPGAELSSMGAIVWAVRAKDYNKAMEFDCLLGISNEFIVLIEQETKSVVFNCS
CRDVIGWTSSDSSLKIFYERGECISVESFMSSEDIKEIVKRLQFVSKGCESVEMTLRRNG
LGQLGFHVNYEGIVADVEPYGYAWQAGLRQGSRLVEICKVAVATLSHEQMIDLLRTSVTV
KVVIIPPHDDCTPRRSCSETYRMPVMEYKMNEGVSYEYKFPFRSNNKWQRNAGKGAHSPQ
VPSQLQSPMTSRLNAGKGDGKMPPPERAANIPRSISSDGRPLERRLSPGSDIYVTVSSMA
LARSQCRNSPSNLSSSSETGSGGGTYRQKSMPEGFGVSRRSPASIDRQNTQSDIGGSGKS
TPSWQRSEDSLADQMEPTCHLPAVSKVLPAFRESPSGRLMRQDPVVHLSPNKQGHSDSHY
SSHSSSNTLSSNASSAHSDEKWYDGDRTESDLNSYNYLQGTSADSGIDTASYGLSHGSTA
SLGASTSSPRSGPGKEKVAPLWHSSSEVLSLADRTLETEGHGMDRKTESSLSLDIHSKSQ
GGSSPLTRENSTFSINDATSHTSTMSSRHSASPVVFSSARSSPKEELHPTTSSQLAPSFS
SSSSSSSGPRTFYPRQGATSKYLIGWKKPEGTINSVGFMDTRKRHQSDGNEIAHTRLRAS
TRDLRASPKPTSKSTIEEDLKKLIDLESPTPESQKNFKFHGLSSPQSPFPSTPTSRRALH
RTLSDESIYSSQREHFFTSRASLLDQALPNDVLFSSTYPSLPKSLPLRRPSYTLGMKSLH
GEFSASDSSLTDIQETRRQPIPDPGLMPLPDTASDLDWSNLVDAAKAYEVQRASFFAASD
ENHRPLSAASNSDQLEEQALVQMKSYSSSKDSSPTLASKVDQLEGMLKMLREDLKKEKED
KAHLQAEVEHLREDNLRLQEESQNASDKLKKFTEWVFNTIDMS
NT seq 5352 nt   +upstreamnt  +downstreamnt
atgaccagcttgaagaggtcgcagaccgaaaggcctgtcactgctgacagagcctctgtt
gtcagcacagatggcacccccaaagttcacactgatgatttctacatgcgtcgcttccgg
tcccaaaatggcagcttaggatcatcagtcatggctgcagtagggccccctcgaagtgaa
ggtcctcaccatataacctcaacccccggagtccccaagatgggggttagggcaagaatt
gcagattggcctccaagaaaggaaaatgtaaaagaatctagccgttcaagccaggaaata
gaaacctcaagttgccttgagagcctgtcctccaaaggcagtcctgtgagtcaggggagt
tctgttagcctcaattccaatgactcagccatgctgaagagcatccagaacaccctgaag
aacaagacggggccagcggagagcatggactcgagattcctcatgcctgaagcctacccc
agctcccccaggaaagcccttcgccgaatccgtcagcgtagcaacagtgatatcaccata
agtgagcttgatgtggatagttttgatgaatgtatctccccaacctacaagtcggggcca
tcattgcacagggaatatggtagcacatcttcaatcgacaagcaggggacatccggagaa
agcttcttcggtttgttaaagggctataaagacgacagagctgaccgaggtccaactcca
accaaactcagtgacttcctcatcactggtgggggcaagggttctggtttctccttggat
gtgatcgatggacccatctcacagagagagaacctcaggctattcaaggaaagggaaaaa
ccactcaagcgacgctctaagtctgaaactggagactcatccatttttcgtaaattacgc
aatgccaaaggtgaagaactcgggaagtcatcagaccttgaagacaacagatcagaggat
tctgtgaggccctggacatgtccaaagtgctttgcccactatgatgtccagagcatattg
tttgacttgaatgaagccattatgaacaggcataatgtgattaagaggagaaacaccaca
acgggagcttccgcagccgctgtggcgtccttagtctcgggacctttgtctcactcagcc
agcttcagctctcctatgggcagcacagaggacctcaattccaaaggaagcctcggcatg
gaccagggagatgacaagagcaatgaactcgtcatgagctgtccgtactttcggaatgag
attgggggagaaggtgagaggaaaatcagcctgtccaagtccaattctggctcattcagt
gggtgtgagagcacgtcctttgagtctgccctcagctctcactgcacaaacgcaggagtg
gcggttctcgaagtgcccaaggagagcttgatgctgcatctagacagagtgagacggtac
actgtggagcacgtggatcttggagcatactattacaggaagtgcttctaccaaaaggaa
cactggaactattttggggctgatgaaaacctcggtccagtggctgtgagcattcgaagg
gaaaaaccagaagacatgaaggaaaatggatctccctacaactaccgaataatttttaga
actagtgagctcatgacactgagagggtctgtcctggaggatgccattccctccacagcc
aagcactcgacagccagaggattgccgctgaaagaggtgctggaacatgtgatcccagag
ctcaacgtgcagtgcctgcgtttggccttcaacacgcccaaagtcacggagcagcttatg
aaactggacgagcaagggctgaactatcagcagaaagtaggcatcatgtactgcaaagca
ggccagagcaccgaggaggagatgtacaataatgagtccgctggcccggcctttgaggaa
tttcttcagctactgggagagcgagttcgcctaaaaggatttgaaaagtatcgtgcgcag
ctcgacaccaaaactgactccactggaacccactctctgtacacaacctacaaagactat
gagataatgttccacgtctccaccatgctgccctacacacctaacaacaagcaacagctc
ctgaggaagcggcacattgggaatgacattgtgacaatagttttccaggagcctggagca
caaccatttagcccgaaaaacatccgatctcactttcagcatgtttttgtcattgtccgg
gctcacaacccctgcactgagagtgtctgttacagtgtggcagtcaccaggtccagagat
gtgccttcttttggacctcccatccctaaaggggtcaccttccccaagtcaaacgtgttc
agggacttccttttggccaaagtgattaatgcagaaaacgctgctcataaatcagagaag
ttcagggccatggcaacaaggacccgccaggaatacctgaaagatctggcagaaaagaat
gtcaccaacacacctattgacccttctggcaagtttccatttatttctctggcttctaag
aagaaggaaaagtctaagccttacccaggagctgagctcagtagcatgggggccattgtg
tgggcagtccgggccaaagactacaacaaggccatggaattcgactgcctccttggaatc
tccaatgagttcatcgtcctcattgagcaggaaacaaagagcgtggttttcaattgctcc
tgcagagatgtgatagggtggacttccagcgacagcagccttaagatcttctatgagcgt
ggagaatgcatttctgtggagagcttcatgagcagtgaagatatcaaagaaattgtcaaa
aggctgcagtttgtttcaaaaggttgtgaatcagtggagatgacgctgcgaagaaatggg
ctaggccagcttggcttccatgtcaactatgagggcatcgtggcggatgtagaaccctat
ggctatgcatggcaagcaggtttgaggcagggcagccgcctggtggagatctgcaaggtg
gcagtggccaccctgagccatgaacagatgatcgatctcttgagaacgtcagtcacagtg
aaagttgtcattatccctccccatgatgactgcacccctcggaggagttgctcagaaacc
taccgcatgccagtgatggagtacaagatgaatgaaggcgtttcctatgagtacaagttt
cccttccggagtaacaacaaatggcagcgtaatgccggcaagggtgcccactcgccccag
gttccatcgcagctgcagagccccatgacttcacggctgaatgctgggaagggagatgga
aagatgccccctccagaaagagccgccaacatccctcgaagcatctccagtgatgggcgc
ccactggaaaggaggctgtctccgggttcggacatctatgtgacagtctcatccatggct
ttggcgagatcccagtgccgtaactcccccagcaacttgtcatcgtccagcgagactggc
tctgggggtggcacttacagacaaaaatccatgcctgaagggtttggagtgagccgaaga
tccccagcttccatcgacaggcaaaacacccagtcggatattggtggcagtggaaaatcc
acacccagctggcagagaagtgaggacagccttgccgaccagatggagcctacatgccat
ctcccagcagtatctaaggtactgcctgctttccgagagagccccagtgggaggttgatg
cggcaggatcccgtggttcacttgtctccaaacaagcaaggccattctgacagccactac
tccagccactccagcagcaacactctgtccagcaacgcctcgagtgcccacagtgacgag
aagtggtacgatggagaccgcaccgagtccgacctcaacagctataactacctacagggc
acatctgctgacagcggcatcgacaccgcctcatacggcctcagccatggcagcacggcc
tccctgggagcctccacatcctcacctcgttcagggccaggcaaagagaaggtggcaccc
ctgtggcacagctccagtgaggtgctctccctggcagatcggaccttagagactgagggc
catggcatggacaggaaaacagagtcctccctgagcctggacatccacagcaagagccaa
ggcggttcaagcccgctgacaagggagaacagcaccttcagcataaatgatgccacatct
cacaccagtaccatgagctcccgacactctgccagcccagtggtgttctccagtgccaga
agttcacccaaagaggagcttcaccccaccacgtcctcccagctcgcaccttccttctct
tcctcttcctcatcttcctctggacctaggactttctatccccgccagggcgccactagc
aaatacctgattggatggaaaaagccagaaggaaccattaactccgtgggatttatggat
acaagaaagcgacatcagagtgatggtaatgagatagcccacactaggcttcgagcctca
accagggaccttcgggcatccccaaagccaacttccaagtccaccattgaggaggatcta
aagaaactcatcgaccttgagagcccaactcctgaatcacagaaaaacttcaagttccat
ggactgtcctccccacagtccccgttccccagcacccctacctcccggcgggccctgcac
aggactctgtctgatgagagcatttacagcagccagagggagcatttcttcacctccagg
gcctcacttctagaccaagccctgcccaatgatgtcctcttcagcagcacctacccatct
ctccccaagtcgcttccactgaggaggccatcttacacattgggaatgaagtcgctgcat
ggagagttctctgcttccgacagctcccttaccgacatccaggagacccggaggcagcct
attcctgaccctggcctgatgcccctgcctgacactgcttcggacttggactggtccaac
ctagtagatgccgccaaagcctatgaggtccagagagcctcattttttgctgctagtgat
gaaaaccatcgccccttgagtgcggcctccaacagcgaccagctagaggagcaggccctg
gtccagatgaagtcgtacagcagcagtaaggactcctctcccactctggcttctaaagtg
gaccagttggaaggtatgctgaaaatgcttcgagaagatttgaagaaggaaaaggaagac
aaggcccacctgcaggcagaggttgagcacttgcgggaggacaacctgaggctgcaggag
gagtcccagaatgcctcggacaagctgaagaagttcacagagtgggtcttcaacaccata
gacatgagctag

DBGET integrated database retrieval system