KEGG   Rattus norvegicus (rat): 246215Help
Entry
246215            CDS       T01003                                 

Gene name
Tpcn1
Definition
(RefSeq) two pore segment channel 1
  KO
K16896  two pore calcium channel protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    246215 (Tpcn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    246215 (Tpcn1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, two-pore (TPC)
   246215 (Tpcn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Pilin_N
Motif
Other DBs
NCBI-GeneID: 246215
NCBI-ProteinID: NP_647548
RGD: 708494
Ensembl: ENSRNOG00000059344
UniProt: Q9WTN5
Position
12q16
AA seq 817 aa AA seqDB search
MSVILDDDVLLILTLDEELSAPLTPSNGLGQEDLPSKNGGGQSGPNSQVPSLVSGADSPP
SSPPGHNWEMNYQEAAIYLQEGQNNDKFFTHPKDARALAAYLFVHNHFFYMMELLTALLL
LLLSLCESPAVPALKLRTYVHATLELFALMVVVFELCMKLRWLGFHTFVRHKRTMVKTSV
LVVQFIEAIVVLVRQTSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDILLLL
LFFMIIFAILGFYLFSTNPSDPYFNTLENSIVNLFVLLTTANFPDVMMPSYSRNPWSCVF
FIVYLSIELYFIMNLLLAVVFDTFNDIEKHKFKSLLLHKRTAIQHAYHLLVSQRRPAGIS
YRQFEGLMRFYKPRMSARERFLTFKALNQSNTPLLSLKDFYDIYEVAALQWKAKKNRQHW
FDELPRTAFLIFKGINILVNSKAFQYFMYLVVAVNGVWILVETFMLKGGNFISKHVPWSY
LVFLTIYGVELFMKVAGLGPVEYLSSGWNLFDFSVTAFAFLGLLALTLNMEPFYFIVVLR
PLQLLRLFKLKKRYRNVLDTMFELLPRMASLGLTLLTFYYSFAIVGMEFFSGRLSPNCCN
SSTVADAYRFINHTVGNKTKVEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQ
TSHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKSQESEVDSGIVIEKEMSKEE
LLAILELHREARGTSSDITRLLDTLSQMEKYQQNSMVFLGRRSRTKSDLSLKMYQEEIQE
WYEEHAREQEQQQLRGSAPSPAAQQTPGSRQRSQTVT
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaattttagacgacgacgtgctgctcatcctgaccttggacgaggagctgagt
gcgccgctgactccttccaacggcctgggccaagaagacctgcccagcaaaaatgggggc
ggccaaagcggccccaactcccaagttcccagtctggtctctggagccgacagtcccccc
tccagtccccccggacacaactgggagatgaattatcaagaggcagcaatctacctccag
gaaggccagaacaatgacaagttcttcacccaccccaaggatgccagagcgctggctgcc
tacctcttcgtacacaaccacttcttttatatgatggagctgctcacagccctgcttctg
ctgctgctgtcactgtgcgagtcacccgctgtccctgcgctcaagctccgaacttacgtc
cacgccaccctggagctgttcgccctcatggtggtggtatttgaactctgcatgaaattg
cggtggctgggcttccacacattcgtcaggcacaaacgcaccatggtcaagacgtctgtt
ttggtggtgcagttcatcgaggccattgtggtgctggtgcggcagacgtcccacgtgcgg
gtgacccgggcactacgctgcattttcctggtggactgtcggtactgtggtggcgtgcgg
cgcaacctgcggcagatcttccagtcgctgccgcctttcatggacatcctcctgctgctg
ctcttctttatgatcatcttcgccatcctcggtttctacttattctctacgaacccttcc
gacccttacttcaacaccctggagaacagcatcgtcaacctgtttgttctcctgaccaca
gccaactttccagacgtcatgatgccctcctactcccggaacccctggtcctgtgtcttc
tttatcgtgtacctctccattgagctgtacttcatcatgaacctgctcctagccgtggtg
ttcgacaccttcaacgacatcgaaaagcacaagttcaagtccttgctgctgcataagcga
acagccatccagcacgcataccacctgctcgtcagccaacggaggccggccggcatctcc
tacaggcagtttgaaggcttgatgcgcttctacaagccccggatgagcgctagggagcgc
ttcctgactttcaaggccctgaatcagagcaacacacctctgcttagcctgaaggacttc
tatgatatttatgaagttgctgctctgcagtggaaggcaaagaagaacagacagcactgg
tttgacgagcttccccggacagccttcctcatcttcaaagggattaacatccttgtgaat
tccaaggccttccagtatttcatgtacctggtggtggctgtcaacggtgtctggatccta
gtggagacattcatgttgaaaggtgggaatttcatctcaaagcacgtgccctggagttac
ctcgtgtttcttaccatctatggagttgagctgttcatgaaggtggctggcctgggccct
gtggagtacttgtcctctggatggaacctgttcgatttctcagtcacagcatttgccttc
ctgggactgctcgcgctgacgctcaacatggagcccttctactttattgtggtcctgcgt
ccccttcagctgctgaggttattcaagttgaagaaacgctaccgcaatgtgttggacacc
atgtttgagctgctgccacgaatggccagcctcggcctcacactgctcaccttctactac
tccttcgccatcgtgggcatggagttcttcagtgggcgactgtcccccaactgctgcaac
tccagcacggtggctgacgcctatcgattcatcaatcacacggtgggcaataagaccaag
gtggaggaaggctactactatctcaataactttgacaacatcctcaacagctttgtgacc
ttgtttgagctcaccgttgtcaacaactggtacatcatcatggaaggcgtcacctcgcag
acttcccactggagccgcctgtacttcatgaccttttacatcgtgaccatggtggtgatg
accattatcgtggccttcatcctggaggccttcgtcttccgcatgaactacagccgcaag
agccaggaatcggaagtggacagtggcatcgtcatcgagaaggagatgtccaaggaggag
cttctggccatcctggagcttcatcgagaggcgcgaggcacctcctctgacatcacccgg
ctgctcgacaccctctctcagatggagaaataccagcaaaactccatggtgtttctggga
cggcgatcgagaaccaaaagtgacctgagcctgaagatgtaccaggaggagatccaggag
tggtacgaggagcatgcccgggaacaggagcagcagcagctcaggggcagcgcgccaagc
cctgcagcccagcagacccccggcagtcgccagcgctcccagaccgtcacctag

DBGET integrated database retrieval system