KEGG   Rattus norvegicus (rat): 246216
Entry
246216            CDS       T01003                                 

Gene name
Prpf19
Definition
(RefSeq) pre-mRNA-processing factor 19
  KO
K10599  pre-mRNA-processing factor 19 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    246216 (Prpf19)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    246216 (Prpf19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    246216 (Prpf19)
   04121 Ubiquitin system [BR:rno04121]
    246216 (Prpf19)
   03400 DNA repair and recombination proteins [BR:rno03400]
    246216 (Prpf19)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     246216 (Prpf19)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    246216 (Prpf19)
 Complex C
   Prp19-CDC5 complex
    246216 (Prpf19)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  U-box type E3
   246216 (Prpf19)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    246216 (Prpf19)
SSDB
Motif
Pfam: WD40 Prp19 ANAPC4_WD40 U-box eIF2A Cytochrom_D1 Nup160 zf-Nse DUF1830 Nucleoporin_N
Other DBs
NCBI-GeneID: 246216
NCBI-ProteinID: NP_647549
RGD: 708496
Ensembl: ENSRNOG00000020897
UniProt: Q9JMJ4
Position
1
AA seq 504 aa
MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP
IRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARL
TKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKA
TVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTG
GADKNVVVFDKSTEQILATLKGHTKKVTSVVFHPSQELVFSASPDATIRIWSVPNTSCVQ
VVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHP
DGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD
LRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTG
VAFGHHAKFIASTGMDRSLKFYSL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgtccctgatctgctcgatctccaacgaagtgccagagcacccatgcgtgtcccctgtc
tctaatcatgtgtatgagcggcgactcattgagaagtacattgcagagaatggcacagat
cctatcaacaaccagcctctctcagaggagcagctcatcgacatcaaagttgctcatcca
atccggcccaagcctccctctgccaccagcatcccagccattctgaaagccttgcaggat
gagtgggatgcagtcatgctgcacagcttcactcttcgccagcagctgcagacaacccgc
caggaactgtcccacgctctgtaccagcacgatgctgcctgccgagtcattgcccggctc
accaaggaggtcactgctgctcgagaagctctggctactctgaaaccacaggctggtctt
attgtacctcaggctgtgccaagctcacagcccagtgttgtgggtgcaggagagcccatg
gatttgggtgagcttgtgggaatgacccctgagattatccagaagcttcaagacaaggcc
actgtactaaccacggagcgtaagaagagaggaaaaactgtccctgaggagctggtgaag
cctgaagagctcagcaagtaccggcaggtggcatcccatgtggggctacacagtgctagc
attcctgggattcttgctctggacctgtgtccctcagacaccaacaagattcttactggt
ggggcagataaaaacgttgttgtctttgataagagtactgagcaaatcctggccactctc
aaaggccataccaagaaggtcaccagtgtggtgtttcatccttctcaggaattggtgttt
tctgcgtcccctgatgctactatcaggatttggtccgtcccgaacacttcttgtgtacag
gttgttcgggcccatgagagtgcggtgacaggactcagcctccatgccactggagactat
ctactgagctcctctgatgatcagtactgggcgttctctgacattcagacagggcgtgtg
ctcaccaaggtgacagatgagacttccggctgctctcttacctgtgcacagttccaccct
gatggcctcatctttggaacaggaaccatggactcccagatcaagatctgggacttgaag
gaacgcaccaatgtggcgaacttccctggccactccggccccattaccagcattgccttc
tctgagaatgggtactacctggccacggcagctgatgactcctcagtcaagctctgggac
ttacgcaagttgaagaacttcaagacattgcagctggacaacaactttgaggtgaagtca
ctaatctttgaccagagtggcacctacctggcgcttgggggtacagatgtccagatctac
atctgcaaacagtggacagagattcttcactttacagagcatagtggcctgaccactgga
gtggcctttgggcaccacgccaagttcatcgcttcaaccggcatggacaggagcctcaaa
ttctacagtctgtag

DBGET integrated database retrieval system