KEGG   Rattus norvegicus (rat): 246235Help
Entry
246235            CDS       T01003                                 

Gene name
Slc36a2, Pat2, Tramd1
Definition
(RefSeq) solute carrier family 36 member 2
  KO
K14209  solute carrier family 36 (proton-coupled amino acid transporter)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    246235 (Slc36a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    246235 (Slc36a2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    246235 (Slc36a2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    246235 (Slc36a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC36: Proton-coupled amino acid transporter
   246235 (Slc36a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aa_trans
Motif
Other DBs
NCBI-GeneID: 246235
NCBI-ProteinID: NP_647555
RGD: 620492
Ensembl: ENSRNOG00000011892
UniProt: Q8K415
Position
10q22
AA seq 481 aa AA seqDB search
MSVTKSAGSPQVAATVKLDLVSFPESAKKVQSQDPNPVNGSSSESSEKTKGITGFQTLVH
LVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGLIACHCMHILVRCAQRFCHRLNKPFMD
YGDTVMHGLASSPNTWLQSHAHWGRHAVSFFLIVTQLGFCCVYIVFLADNLKQVVEAVNS
TTISCHKNETVVLTPTIDSRLYMLAFLPVLGLLVFIRNLRVLTIFSLLANVSMLVSLVII
GQYIIQGIPDPSQLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKDARRFPTILSLG
MSIITTLYIAIGALGYLRFGDDIKASITLNLPNCWLYQSVKLLYVVGILCTHALQFYVPA
EIIIPLAVSQVSKRWALPVDLSIRLALVCVTCMLAILIPRLDLVLSLVGSVSSSALALII
PPLLEVTTYYGEGMSPLTITKDALISILGFMGFVVGTYQALDELIRSGNSLPLSNSTMFI
Q
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaccaagagtgccgggagtccgcaggtggctgccactgtcaagctggacctt
gtgtcgtttcctgagagtgccaagaaggtgcagagccaggatcccaatccagtgaatggg
agctcttcagagtcgtcagagaagaccaagggcattacagggttccagacattggttcat
ctggtcaaaggcaacatgggcacagggatcctgggactycccctggctgtgaagaatgcg
ggcatcttgatgggcccactcagcttgctagtgatgggcctcatcgcctgccactgtatg
cacatcctagtccgatgtgcccagcgcttctgtcacagactcaacaagcctttcatggat
tatggagacacagtgatgcatggactggcttccagtcccaacacctggctgcaaagccac
gcccactgggggaggcatgctgtgagcttcttcctcatcgtcacacagctgggtttctgc
tgtgtgtacatcgtgtttctggcggacaatttaaaacaggtagtagaagctgttaacagc
acaaccatcagctgccacaagaacgaaacggtagttctgacgcccaccatagactctcga
ctctacatgctcgccttcctgcccgtcctggggcttctggtattcatcaggaacctccgc
gtcctcaccatcttctccctgttggccaacgtcagcatgctggtcagcctggtcatcatt
ggccagtacatcatccagggaattccagatcccagccagttgccactggtagcaagctgg
aagacctacccgctcttctttggaacagccattttttcattcgaaagcatcggcgtggtg
ctgcctctggaaaacaagatgaaggatgcccgccgcttcccaaccattctgtctttggga
atgtccatcatcaccaccctgtacattgccatcggggctctgggctacctgcggtttgga
gacgacatcaaagccagcatcactcttaacctgcccaactgctggctgtaccagtcagtc
aagctcctgtatgtcgtcggcatcctgtgtacccatgccttgcagttctacgtccctgcg
gaaatcatcatccccctcgctgtctcccaggtgtcaaaacgctgggcactgcctgtggac
ctgtccatccggctcgccctggtctgcgtcacatgcatgctggccatcctcatcccccgc
ctggacctggtcctctccctggtgggctctgtgagcagcagtgccctggccctcatcatc
ccgcccctgctggaggtgaccacctactatggagagggcatgagccccctgaccatcacc
aaggatgccctcatcagcatcctgggcttcatgggatttgtggtggggacctaccaggcc
ctggatgagctgatcaggtccgggaacagtctccccctgtccaactccactatgtttatt
cagtga

DBGET integrated database retrieval system