KEGG   Rattus norvegicus (rat): 246238
Entry
246238            CDS       T01003                                 

Gene name
Bpifa1
Definition
(RefSeq) BPI fold-containing family A member 1 precursor
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LBP_BPI_CETP
Other DBs
NCBI-GeneID: 246238
NCBI-ProteinID: NP_742028
RGD: 619818
Ensembl: ENSRNOG00000013859
UniProt: Q8K4I4
Position
3
AA seq 270 aa
MFLVGSLVVLCGLLAQSTAQLAGLPLPLGQGLPLPLGQGLPLPLGQGLPLAVSPALPSNP
TDLLAGNFANALSGGLLSGGLLGILENIPLLDVIKSGGGSSNGLVGGLLGKLTSSVPLLN
NILDIKITDPRLLELGLVQSPDGHRLYATIPLSLKLQVNMPVVGSFLQLAVKLNITAEIV
AMKDNQGRIHLVLGDCTHSPGSLQITLLNGVTPVQSSLDSLTGILTKVLPELIQGKVCPL
INGILSGLDVTLVHNIAELLIHGIQFVIKV
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtttctagttgggagtcttgtcgtcctctgtgggctgctggcccagagcacagcccag
ctagcaggcctgcctttgccccttgggcagggtctgcctttgcccctggggcagggtctg
cctttgcccctggggcagggtctgcctttggccgtgagcccagcactgccttcaaatccc
acagatcttcttgctggaaacttcgcaaatgctctcagtggtggcctgctctctggggga
ctgctgggcatcttggaaaatattccactcctggatgttataaagtctggaggaggcagt
tccaatggccttgttgggggcctgcttggaaaactgacgtcatcagtccctctcctgaac
aacatccttgacataaaaatcactgatcctcggctgctggaacttggccttgtgcagagc
cctgatggccatcgtctctacgccaccatccctctgagcttgaaactccaagtgaatatg
cccgtggttggaagttttttgcaacttgctgtgaagctgaacatcaccgcagagattgta
gccatgaaagacaatcaggggaggatccatctggttcttggtgactgcacccactcccct
ggcagcctgcaaatcaccttgctcaatggagtcactcctgttcagagctctttagacagc
ctcacagggatactgactaaagtccttcctgagctgatccagggcaaggtatgccctctg
atcaatgggattctcagcggtttggatgtcaccctggtgcataacattgctgaattactg
atccatggaatacaatttgtcatcaaagtttag

DBGET integrated database retrieval system