KEGG   Rattus norvegicus (rat): 246240
Entry
246240            CDS       T01003                                 

Gene name
Ripk3
Definition
(RefSeq) receptor-interacting serine/threonine-protein kinase 3
  KO
K08847  receptor-interacting serine/threonine-protein kinase 3 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04668  TNF signaling pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    246240 (Ripk3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    246240 (Ripk3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    246240 (Ripk3)
   04623 Cytosolic DNA-sensing pathway
    246240 (Ripk3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    246240 (Ripk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    246240 (Ripk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     246240 (Ripk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   246240 (Ripk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RHIM TfuA APH Pkinase_fungal
Other DBs
NCBI-GeneID: 246240
NCBI-ProteinID: NP_647558
RGD: 628899
Ensembl: ENSRNOG00000020465
UniProt: Q9Z2P5
Position
15
AA seq 478 aa
MSSVKLWLNGASSISLVGSEELENLGFVGKGGFGAVFRARHTAWNLDVAVKIVNSKKISR
EVKAMVNLRHENVLLLLGVTENLEWDYVYGPALVTGFMENGSLSGLLQPSCPRPWPLLCR
LLEEVVLGMCYLHSLNPSLLHRDLKPSNVLLDLELHAKLADFGLSTFQGGSQSGSGSGSR
DSGGTLAYLAPELLDNDGKASKASDVYSFGVLVWTVLAGREAEVVDKTSLIRGAVCNRQR
RPPLTELPPDSPETPGLEGLKELMTHCWSSEPKDRPSFQDCESKTNNVYILVQDKVDAAV
SKVKHYLSQYRSSDTKLSARESSQKGTEVDCPRETIVYEMLDRLHLEEPSGSVPERLTSL
TERRGKEASFGHATPAGTSSDTLAGTPQIPHTLPSRGTTPRPAFTETPGPDPQRNQGDGR
NSNPWYTWNAPNPMTGLQSIVLNNCSEVQIGQHNCMSVQPRTAFPKKEPAQFGRGRGW
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcttctgtcaagttatggctcaatggtgcgtcatcgatctctctcgtgggctctgaa
gaactggagaacctaggatttgtgggcaaaggcgggttcggagccgtgttccgggcacgc
cacacagcatggaaccttgatgtagcagtcaagatcgtgaactcgaagaagatatccagg
gaggtgaaggctatggtgaatcttcgtcatgagaacgtgctgctcctgctgggggtcact
gagaacctcgagtgggactacgtgtacgggccggctctggtgacaggattcatggagaac
ggctccctctcagggctgctgcaaccttcatgccctcggccctggcctctcctctgtcgc
ctgctagaggaagtggtgctggggatgtgctacctacacagcttgaacccttcgctactg
caccgggacctcaagccctccaatgttctgctggatctagagctccacgccaagttagca
gactttggcctgtccacatttcagggagggtcacagtcagggtcagggtcaggatcgaga
gattctgggggcaccctagcttacttggccccagagctgttggataatgacggaaaggct
tctaaagcaagtgatgtttacagttttggggtcctcgtgtggacagtgttggctggaaga
gaagctgaggtggtagacaagacctcactaattcgtggagcagtgtgtaacaggcagagg
cgacctccattgacagagctgcctccggacagccctgagactcctggcttagaaggactg
aaggagttaatgacgcattgctggagttctgagcctaaagacaggccatccttccaagac
tgtgaatcaaaaaccaataatgtttacatcctggtacaggacaaggtagatgctgctgtc
tccaaggtaaagcattatctgtctcagtacagaagcagtgacacaaagttgtctgccaga
gagtccagccaaaaaggtacagaggtggattgccccagggaaaccatagtttatgaaatg
ctggaccgcctgcatctggaggagccctctggatcagttcctgaaagactcacaagtctt
actgagaggagaggaaaggaagcatcatttgggcatgccacaccagcagggacatcatct
gacaccttggctggcactccccaaattccacatactctaccctccagaggcacaacacct
aggccagcctttactgagactccaggtcctgacccccaaaggaatcagggagatggaaga
aacagcaatccttggtacacctggaacgcaccaaacccaatgacaggcctacagtctatt
gtcttaaacaactgttctgaagtgcagattggacaacacaactgcatgtcagtacaaccg
agaactgcctttcccaagaaggagccagcacagttcggcaggggtaggggctggtag

DBGET integrated database retrieval system