KEGG   Rattus norvegicus (rat): 246245Help
Entry
246245            CDS       T01003                                 

Gene name
Fmo2
Definition
(RefSeq) flavin containing monooxygenase 2
  KO
K00485  dimethylaniline monooxygenase (N-oxide forming) [EC:1.14.13.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00982  Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    246245 (Fmo2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.8  flavin-containing monooxygenase
     246245 (Fmo2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FMO-like Pyr_redox_3 Pyr_redox_2 K_oxygenase NAD_binding_8 Pyr_redox DAO Shikimate_DH NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 246245
NCBI-ProteinID: NP_653338
RGD: 628600
Ensembl: ENSRNOG00000003510
UniProt: Q6IRI9 G3V6F6
Position
13q22
AA seq 535 aa AA seqDB search
MVKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGLWRFKENVEDGRASIYHSVIT
NTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVISVKKRPDFA
SSGQWDVYVQSNGKEQRAVFDAVMVCSGHHIQPHLPLKSFPGIERFQGQYFHSRQYKHPV
GYEGKRILVVGIGNSAADIASELSKRAAQVFVSTRHGSWVLSRISEDGYPWDMVFHTRFS
SMLRNVLPRTVVKWMMERQMNRWFNHENYGLVPQNKYLMKEPVLNDDLPSRLLYGAIKVK
TRVKELTETAVVFEDGTVEEDVDVIVFATGYTFSFPFLEDSLVKVEDNKVSLYKAMFPPH
LEKPTLACIGLIQPLGSIFPTVELQARWATRVFKGVCRLPSETTMMADIAERNEKRIDLF
GKSQSQILQTNYIDYLDELALEIGAKPDFISLLFKDPKLAVKLYFGPCNSYQYRLVGPGQ
WEGARNAILTQKQRILKPLKTRTLQTSASAPVSFLIKVLGLLAIVLAFFFKLHGF
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaaggttgccgtgattggagcaggggtcagtggcctgatctctctaaagtgc
tgcgtggacgagggtctggagcccacctgctttgaaaggactgaggatatcggaggactg
tggaggttcaaagaaaacgtggaagatggccgagccagcatctaccactctgtcatcacc
aacactagcaaagaaatgtcctgcttcagtgacttcccaatgccggaggatttccccaac
ttcctgcacaactctaaactcctggaatacttcaggatctttgccaagaaatttgatctc
ctaaaatatattcagtttcagacaaccgtcattagtgtgaagaaacgcccagatttcgca
tcttctgggcagtgggacgtgtatgttcagagcaatggcaaggagcagcgtgctgtcttt
gacgccgttatggtctgcagcggccatcacatccagccccacctgccactcaagtcgttt
ccaggtatcgagaggttccaaggccagtatttccatagccgccaatacaagcacccagtg
gggtatgaggggaaacgcatcctagtggttggaataggaaactccgccgcagacattgcc
tctgaactgagtaagagggccgcgcaggtgtttgtcagcaccagacatggttcctgggta
ttgagccgaatctctgaagatggctacccttgggacatggtgttccacactagatttagc
tccatgctccggaatgtcctgccccgcacggtcgtcaagtggatgatggaacgacagatg
aatcgatggttcaaccatgagaattacggcctggtgcctcagaacaaataccttatgaaa
gaacctgtattaaacgacgacctccccagccgcctgctgtacggagccatcaaagtaaaa
acacgggtaaaggagctcacggagacagctgtggtcttcgaggatggcacggtggaggaa
gacgtggatgtcattgtctttgccacagggtatacgttctcttttcctttcctggaagac
tcgcttgttaaagtagaggataataaggtctcgctgtacaaagccatgtttccccctcac
ctggagaagccaacccttgcgtgcataggtctcatccagcctctgggctccatcttccca
accgtagagcttcaggcgcggtgggcgacaagagttttcaaaggcgtgtgtcgcttgcct
tcggagacgacgatgatggcagacattgctgaaagaaatgagaaaagaattgacctgttt
ggaaaaagccagagccagattctgcagaccaattacattgattacctggatgaactcgcc
ttggagataggtgcgaagccggacttcatctctctccttttcaaagaccctaaactggct
gtgaaactctacttcggaccctgcaattcctaccagtaccgcctagttggacctgggcag
tgggaaggagccaggaatgccatcctcacccagaagcagcggatcctgaagccgttaaag
actcgcactctccagacctcagctagtgccccagtgtctttcctgattaaggtcctgggg
ctgcttgctattgttctggccttctttttcaagcttcatgggttctaa

DBGET integrated database retrieval system