KEGG   Rattus norvegicus (rat): 246247
Entry
246247            CDS       T01003                                 

Gene name
Fmo4
Definition
(RefSeq) flavin containing monooxygenase 4
  KO
K00485  dimethylaniline monooxygenase (N-oxide forming) [EC:1.14.13.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00982  Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    246247 (Fmo4)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.8  flavin-containing monooxygenase
     246247 (Fmo4)
SSDB
Motif
Pfam: FMO-like Pyr_redox_3 K_oxygenase Pyr_redox_2 DAO NAD_binding_8 NAD_binding_9 Pyr_redox 2-Hacid_dh_C AlaDh_PNT_C
Other DBs
NCBI-GeneID: 246247
NCBI-ProteinID: NP_653147
RGD: 628601
Ensembl: ENSRNOG00000003400
UniProt: Q8K4B7
Position
13q22
AA seq 560 aa
MAKKVAVIGAGVSGLSSIKCCLDENLEPTCFERSSDFGGLWKFAEASEDGMTRVYRSLVT
NVCKEMSCYSDFPFHEDYPNFMSHEKFWDYLREFAEHFGLLKYIRFKTTVRSVTKRPDFS
ETGQWEVVTETEGKQDRAVFDAVMVCTGQFLSPRLPLESFPGIHKFKGQILHSQEYRIPD
AFRGKRILVVGLGNTGGDVAVELSGIAAQVFLSTRTGAWVRSRSSVGGYPLNMMQTRWRN
FLARVLPSRFVSWNQERQMNKIFNHENYGLSIAKGKKPKFIVNDELPTCILCGKITMKTS
VKDFTESSIVFEDGTIEANIDVVIFTTGYEFSFPFFEEPLKSLCTKKVILYKRVFPPNLE
RSTLAIIGLISLTGSILVGTEFQARWATRVFKGLCNIPPSQKLMAEAIKKEELIKRGVIK
DTSQDKLDFISYMDELTQCIGAKPNIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGRWDG
ARNAILTQWDRTVKPLKTRTVPKSQEPASLSRYLKTWGAPVLIVSLLLIYKSSLFLELVQ
SKLQGRFSPSRILWYIPQNS
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggccaagaaagtggcagtgattggagctggagtgagtggcctgtcctcaatcaagtgc
tgcttggacgagaacctggagcctacctgttttgagaggagtagtgacttcggcggactg
tggaagtttgctgaagcatctgaggatggaatgaccagggtttacaggtcactagtgaca
aatgtctgcaaggaaatgtcatgttacagtgacttcccattccacgaagattaccccaat
ttcatgagccatgagaaattctgggactatctcagagaatttgctgagcacttcggcctc
ctgaaatatattcggtttaagactactgtgcggagtgtaactaagcgtccagacttctct
gaaactggccaatgggaagttgtcacagagacagagggcaaacaggacagagctgtattt
gatgctgttatggtttgcactgggcaattcctgagcccacgtttacctctggagtccttc
cctggaatccataagtttaaaggacagatcctacacagccaagagtacaggattccagat
gcctttcggggcaagcgcatcctggtggttggtcttggaaacactggcggggatgtcgca
gtggagctcagtggaatagcagcacaggtgtttctcagcactaggactggtgcctgggtt
cgcagccgctcctcagttggtggctaccctttgaatatgatgcagacaagatggcgcaac
ttcctcgcacgagttctgccctcccgctttgtaagctggaatcaagagaggcaaatgaat
aaaatatttaaccatgagaactatggattaagcattgcaaaagggaaaaaaccaaaattt
attgtgaatgatgaactaccaacttgtatcctctgtgggaaaatcaccatgaaaaccagc
gtgaaggattttacagaatcctctatcgtctttgaagatgggacaatagaagccaacatt
gatgtagtgatcttcactacaggatatgaattttcttttcccttttttgaagagcctctc
aaaagcctttgcacaaagaaggtcatactatacaagcgagtgtttcccccaaatttggag
agatcaacattagccatcattggcctgatcagccttactgggtctatcttagtgggcaca
gagttccaagcacggtgggccacgagagtattcaaagggctctgtaatatacctccatct
cagaaactgatggccgaagccattaaaaaggaagagctcattaaaaggggtgtgattaaa
gataccagccaagacaaactcgacttcatttcctacatggatgagctcactcagtgcata
ggcgcgaagcccaatattccacttctgttccttaaggacccaagattggcgtgggaagtt
ttctttggaccatgtaccccttaccaatatcgcctaatgggccctggaagatgggacgga
gccagaaatgccatcctgacccagtgggacaggactgtgaaaccactaaagactcgaact
gttcctaagtcccaggagcctgcctccctctcacgttacttaaaaacttggggggcacct
gtcctgattgtctctcttttacttatctacaagtcttcactgtttcttgaactggtgcaa
agtaagctgcaaggaaggttttccccttcccgaatactgtggtacatcccccagaactca
tga

DBGET integrated database retrieval system