KEGG   Rattus norvegicus (rat): 246249Help
Entry
246249            CDS       T01003                                 

Gene name
Arhgap4
Definition
(RefSeq) Rho GTPase activating protein 4
  KO
K20122  Rho GTPase-activating protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    246249 (Arhgap4)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    246249 (Arhgap4)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    246249 (Arhgap4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP FCH SH3_1 SH3_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 246249
NCBI-ProteinID: NP_653341
RGD: 628901
Ensembl: ENSRNOG00000058545
UniProt: Q8K4G7
Position
Xq37
AA seq 965 aa AA seqDB search
MAAHGKLRRERGLQPEYEAQVKVMRGQLSEQLHCLELQGELRRDLLLELAEFMRRRAEVE
LEYSRGLDKLAERFTSRSGRLGGSSREQQSFRKEPTLLSPLHCWAMLLEHTRQQSRESAT
LSEVLAGPLAQRLSHIAEDVGRIVKKSKDLVQQLQDELLEVVSELQTQGYLAWASLQTKK
TYHVYHLESMNAETKLREAERQEEKRSGKSALPTTTAASATTTITIETELHRKGSLKKGG
RLVEKRQAKFLEHKLKCTKARNEYLLSLASVNAAVSNYYLHDILDLMDCCDTGFHLALEQ
ALRSYTAAESRTQTSHMQGLGSLEEALEALDPPGDKAKVLEVHAMAFCPPLRFDYQPHEG
DEVAEIQVEMELRDEILPRAQNIQSRLDQKTIETEEVNKTLKATLQALLEVVASEDGDIL
DSLQASPSTESLKSTSSDPGTRQAGRRRNQQQETETFYITKLQEYLSGRSILAKLQAKHE
KLQEAIQRGNKEEQETSSWTQCTERKFHKSHHPYPGSQCTQRLFGGDLEKFIQSTGQPVP
LVVKSCIRFINLNGLQHEGIFRVSGAQARILEIRDAFERGEDPLVEGCTAHDLDSVAGVL
KLYFRSLEPPLFPLDMFNELLASAELEVVGERVELVSHLLSRLPRPVLVVLRYLFTFLNH
LAQYSDENMMDSYNLAVCFGPTLLPVPAGQDPVALQGRVNQLVQTLILQPAWVFPPTAML
PGPIYEKCMAPPSASCLGDGQLESLAGEPELELKTGTKAQEDDSEGVVEAVACFAYTGRT
AQELTFQQGDTLRLYARASSDWWRGEHAGVRGLIPHKYITLSEGDEKQMTGSGLQAMGES
LSHPESVLTLEFTNRLELGTPPEALGPSGHRRHCLVPTSPEQHVEMDKAVAQNMDSVFKE
LLGKAAVRQGHGLASTASPSLGTRNLKPLACSSFSKNKVFSRGPGAPVSPSVSHPQGPDS
TRKPV
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcacgggaagttgcggcgggagcggggactgcaacccgagtatgaggcacag
gtcaaagtgatgcgcgggcagttgagtgagcagcttcattgcctggagcttcagggagag
ctgcggcgcgatttgctgctggagctagctgagttcatgcggcgtcgagcagaggtggag
ctggagtattctcggggcctggacaagttggctgaacgctttactagccgcagtggacgc
cttggaggcagcagccgggagcagcaaagtttccggaaggagccaactctcctgtcaccc
ttgcactgctgggctatgctgctggaacatactcggcagcagagtcgggaaagtgctacc
ctcagtgaggtgctggctggacctctggcacagcgcctgagtcacattgccgaggatgta
ggacgcattgtcaaaaagagtaaggacctggtgcagcaactgcaggatgagctcctggag
gtggtctcagaactccagacacagggctaccttgcctgggcctccctgcagaccaagaag
acgtaccatgtataccacttggagagcatgaatgctgagactaaacttcgggaagctgag
aggcaagaggagaagcggtcaggcaagagtgccttgcccaccactactgctgcctctgcc
accaccaccatcaccattgagacagagctccaccgaaagggctctctcaagaaaggaggg
cggctagtggagaagcgtcaggccaagttcttggaacataaacttaaatgcaccaaggcc
cgaaatgagtacctgctcagcctggccagtgtcaatgctgctgtcagcaactactactta
cacgatatcttggacctcatggattgctgtgacacaggtttccacttggccctggagcag
gccctccgaagctacacagccgctgaaagccgcacccaaacctctcacatgcagggttta
ggcagtctggaagaggctctagaggccttggatcctccaggggacaaagccaaagtgctt
gaggttcatgccatggccttctgtccccctctacgttttgactaccagccccatgaaggt
gatgaggtggctgagatccaggttgagatggaacttcgggatgagattttgcccagagcc
caaaacatccaaagtcgcctggaccaaaagaccattgagacagaagaggtgaataagaca
ctgaaggcaacacttcaggctctgctagaggtggtggcatcagaggatggagatatactg
gactctttgcaggccagcccctccactgagtccctcaagtctacaagctcagacccaggc
acccgacaggcaggccgcagacggaaccagcagcaggagacagaaaccttctatattacg
aagctgcaggaatatctgagtggccggagcatccttgccaagctgcaggccaagcatgaa
aagctccaggaagccatacaacgaggtaacaaggaagagcaagagacatcttcttggacc
caatgcacagagagaaaattccataagagccaccacccctatcctggatcccagtgtacc
cagagactttttggaggtgatctagagaagtttatccagagcacaggccaacctgtgccc
cttgtggtgaagagctgtatccgcttcattaacctcaatggcctgcaacatgaaggcatc
ttccgggtatcaggtgcccaggcccggatattggagatccgagatgcctttgaaagaggg
gaggaccctctggtggaaggctgtactgcccatgacctagactcagtggctggggtacta
aagctgtacttccggagcctggagcccccactgttccccttggacatgtttaatgagctg
ctggcttcagcagaactggaagttgtgggtgagcgggtagagcttgtgagccatctacta
tccagactacccagacctgtgctagtggtcttgcgatatctcttcaccttcctcaaccac
ctggcccagtacagcgatgagaacatgatggactcctacaacttggctgtatgttttggg
cccacgctgttgcctgtgcctgctgggcaggaccctgtagccttgcagggccgagtgaac
cagctggtccagacccttatcctgcaaccagcatgggttttcccacccacagccatgcta
ccaggtcccatctatgagaagtgcatggcaccaccttctgccagctgcctgggggatggc
cagttggagagccttgctggggagccagagctggaattgaaaactgggaccaaagctcag
gaagatgactccgagggagttgtggaggctgtggcctgctttgcttacactggccgcacg
gcccaggagctgacattccagcaaggggatacgctgagattgtatgctcgggcatcaagt
gactggtggcgaggggagcatgctggtgtgcgggggctcattccccataagtacatcaca
ctgtctgagggggatgagaagcagatgactggttcaggattacaggccatgggggaatct
ctgagccatccagaaagcgtcctgaccttggagtttaccaaccgactggaactaggcacc
ccacctgaggctttgggcccctctggtcacagacgacactgtttggtccctacctcccct
gagcaacatgtggaaatggataaggctgtggcgcagaacatggattctgtgtttaaggag
ctcttgggaaaggctgctgtccgccagggccatgggctagcatctacagcctcccccagt
ctaggaactcgaaacctgaagcccctggcctgcagcagcttcagcaaaaacaaagtcttc
tcccggggacctggggctccagtttccccctcagtttcccatccccagggtccagattca
actcgcaagccagtctga

DBGET integrated database retrieval system