KEGG   Rattus norvegicus (rat): 246250
Entry
246250            CDS       T01003                                 

Gene name
Retn
Definition
(RefSeq) resistin precursor
  KO
K13438  resistin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    246250 (Retn)
SSDB
Motif
Pfam: Resistin
Other DBs
NCBI-GeneID: 246250
NCBI-ProteinID: NP_653342
RGD: 628781
Ensembl: ENSRNOG00000001001
UniProt: Q8K4J7
Position
12
AA seq 114 aa
MKNLSFLLLFLFFLVLGLLGPSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSS
RGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS
NT seq 345 nt   +upstreamnt  +downstreamnt
atgaagaacctttcatttctcctccttttccttttcttccttgtcctggggctgctgggc
cccagcatgtcactgtgtcccatggatgaagccatcagcaagaagatcaatcaagacttc
agctccctactgccagctgcaatgaagaacactgtcctacattgctggtcagtctcctcc
agagggaggctggcctcctgcccagaaggcacaaccgtcactagctgctcctgtggctct
ggctgtggctcatgggacgtccgtgaggatacaatgtgtcactgccagtgcggaagcata
gactggacagcggcccgctgctgtaccctgcgggttggttcctga

DBGET integrated database retrieval system