KEGG   Rattus norvegicus (rat): 246254
Entry
246254            CDS       T01003                                 

Gene name
Gpsm1, Ags3
Definition
(RefSeq) G-protein signaling modulator 1
  KO
K15839  G-protein signaling modulator 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    246254 (Gpsm1)
SSDB
Motif
Pfam: GoLoco TPR_12 TPR_1 TPR_7 TPR_2 TPR_8 TPR_10 TPR_MalT Rapsyn_N TPR_16 FliJ
Other DBs
NCBI-GeneID: 246254
NCBI-ProteinID: NP_653346
RGD: 628682
Ensembl: ENSRNOG00000018666
UniProt: Q9R080 G3V9X2
Position
3p13
AA seq 673 aa
MASPAPPAAEELPGPAARRLYSRMEASCLELALEGERLCKAGDFKAGVAFFEAAVQVGTE
DLKTLSAIYSQLGNAYFYLKEYARALQFHKHDLLLARTIGDRMGEAKASGNLGNTLKVLG
RFDEAIVCCQRHLDIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAAQDPGHLPPDVRE
TLHRASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAKEFG
DKAAERRAYSNLGNAHIFLGRFDVAAEHYKKTLQLSRQLRDQAVEAQACYSLGNTYTLLQ
DYERAAEYHLRHLVIAQELADRVGEGRACWSLGNAYVSMGSPAQALTFAKKHLQISQEIG
DRNGELTARMNIAHLQLALGRLTSPAAAEKPDLAGYEAQGARPKRTQRLSAETWDLLRLP
LDREQNGETHHTGDWRGPSRDSLPLPMRSRKYQEGPDAIERRPREGSHSPLDSADVRVQV
PRTGIPRAPSSDEECFFDLLSKFQSSRMDDQRCPLEEGQAGAAEATAAPTLEERAAQPSV
TASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITLNNVGHLRGDGDPQEPGDEFFNM
LIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGSPDQEASG
LPDPRQQCPPGAS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggcgagcccggccccgcccgcggccgaggagctcccgggcccagccgccaggcgcctc
tactccaggatggaggcctcctgtctggagctggcactggaaggtgagcggctgtgcaag
gcgggggacttcaaggcaggtgtggccttctttgaggctgccgtgcaggtgggcactgag
gacctgaagacactgagtgctatctacagccagctgggcaatgcctacttctacctgaag
gagtatgccagggccctgcagttccacaaacatgacttgctgctggcacggaccattggc
gaccgcatgggggaagccaaggccagtgggaacctgggcaacacactcaaggtcctgggc
cgattcgatgaggcaattgtctgttgccagcgacacttggacattgcccaggagcagggg
gacaaggttggggaagcgagagcactctacaacattggaaatgtgtaccatgccaagggc
aaacagctatcctggaacgctgcacaggaccctgggcacctgccacctgatgtccgtgag
acactgcacagggcctctgagttctatgagaggaacctgtccttggtgaaggagctaggc
gatcgggcagcccagggcagagcctatggcaacctgggtaacacccactacctgctgggg
aacttcacagaagctacaaccttccacaaagagcgcctggccattgctaaggagtttgga
gacaaggcagctgagaggagagcctacagcaacttgggcaatgctcacatcttcctgggg
cgctttgatgtggctgctgaacattacaagaagacgctgcagctgtctcggcagctccgg
gaccaggccgtggaagcacaggcttgctacagtctggggaacacctacacactgctgcag
gactacgagcgggctgctgagtaccacctgcggcaccttgtcattgcccaggagctggct
gatagggtgggagagggccgagcttgctggagcctggggaacgcctacgtgtccatgggg
agccccgcacaggccttgacctttgccaaaaaacatctgcagatctcccaggagattgga
gaccgaaatggagagctcacggcccgcatgaatattgctcacctgcagctggcactgggc
cggctgactagccctgcggcggcagagaagccagatctggctggctatgaggcacaagga
gcaagacccaaaaggacacagaggctgagtgcggagacctgggacctgctgcggctcccc
ctggaccgggagcaaaatggagagacccaccacacaggggactggaggggtccaagcagg
gactcgcttcctctccccatgaggagcaggaagtaccaggaaggtccagatgccattgag
aggagaccccgggagggtagccactctccactggacagtgctgatgtaagggtacaggtg
cctcgcacgggtatccccagggccccgtcctctgacgaggagtgtttcttcgatctgctg
agtaagttccagagcagtcgtatggatgaccaacgctgtcccctggaggaaggccaggct
ggggctgctgaggctacagctgccccaaccctggaggagagagcggctcagccctctgta
acagcttcaccacagactgaagagttctttgacctcattgccagctcccagagccgccgg
ctggatgaccagagggctagcgtaggcagcctgcctgggcttcgcatcaccctcaacaac
gtggggcacctccgaggcgacggggacccccaggagccaggggatgagtttttcaacatg
cttatcaaataccagtcctccaggattgatgaccagcgctgtccaccccctgatgtgctg
ccccgaggccccaccatgcctgatgaggatttcttcagccttatccagagggtgcaggct
aagcggatggatgagcagcgtgtggacctggctgggagtccagaccaagaggccagtggg
ctgcctgatccccggcagcaatgtccgccaggtgccagctaa

DBGET integrated database retrieval system