KEGG   Rattus norvegicus (rat): 246255
Entry
246255            CDS       T01003                                 

Gene name
Ppp2r2d
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, delta
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04728  Dopaminergic synapse
rno05142  Chagas disease
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    246255 (Ppp2r2d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    246255 (Ppp2r2d)
   04071 Sphingolipid signaling pathway
    246255 (Ppp2r2d)
   04151 PI3K-Akt signaling pathway
    246255 (Ppp2r2d)
   04152 AMPK signaling pathway
    246255 (Ppp2r2d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    246255 (Ppp2r2d)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    246255 (Ppp2r2d)
  09156 Nervous system
   04728 Dopaminergic synapse
    246255 (Ppp2r2d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    246255 (Ppp2r2d)
   05165 Human papillomavirus infection
    246255 (Ppp2r2d)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    246255 (Ppp2r2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    246255 (Ppp2r2d)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    246255 (Ppp2r2d)
   03036 Chromosome and associated proteins [BR:rno03036]
    246255 (Ppp2r2d)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     246255 (Ppp2r2d)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     246255 (Ppp2r2d)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     246255 (Ppp2r2d)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 246255
NCBI-ProteinID: NP_653347
RGD: 708356
Ensembl: ENSRNOG00000016940
UniProt: P56932 A0A0G2JSQ0
Position
1q41
AA seq 453 aa
MAGAGGGGCPTGGNDFQWCFSQVKGAVDEDVAEADIISTVEFNYSGDLLATGDKGGRVVI
FQREQENKGRAHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVFVYSSSKGTIRLCDMRSSALCDRHAKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMEGRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRNTRRDVTLEASRENSKPRASLKPRKVCSGGKRKKDEISVDSLD
FNKKILHTAWHPMESIIAVAATNNLYIFQDKIN
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcaggagccggaggtggcggctgcccgacgggcggcaacgacttccagtggtgcttc
tcgcaggtgaagggcgctgtcgacgaggacgtggcggaagccgacatcatctccaccgtt
gagtttaactactctggagaccttcttgcaacaggagacaaaggtggcagagttgttatt
ttccaacgggaacaagagaataaaggccgcgctcactctaggggagagtacaatgtttac
agtacctttcagagtcatgagccagagtttgactatttgaaaagtctagaaattgaagaa
aaaattaataaaatcaggtggttaccgcaacagaatgctgctcattttctactctctaca
aatgataaaactattaaattatggaaaataagtgaacgagataaaagagcagaaggttat
aacttgaaagatgaagatggacgacttcgagacccatttagaattacggcactacgggtt
ccaatattgaagcccatggaccttatggtagaagcaagtccacgacgaatttttgcaaat
gctcatacatatcacataaattccatttcagtaaatagtgatcatgaaacatatctctct
gcagatgatctgagaattaacctatggcatttagaaatcacagatagaagcttcaacatt
gtggacatcaagcctgctaacatggaggagctgacagaagtcatcactgccgcggagttc
cacccacaccagtgcaatgtattcgtctacagcagcagcaaggggaccatcaggctgtgt
gacatgcgttcttctgccctctgtgataggcatgccaagttttttgaagagccagaagat
cccagcagtagatcctttttctcagaaataatctcatctatatctgatgtcaagttcagc
cacagtggtcgatacatgatgaccagagactatctgtcggtgaaggtatgggacctcaac
atggagggcaggcctgtcgagacccaccaggtacatgagtacctacgaagcaagctctgc
tccttgtatgagaatgactgcatctttgacaagttcgagtgctgctggaatggttcagac
agtgccattatgacggggtcctacaacaacttctttagaatgtttgatagaaacactcgg
agggatgttacactggaagcctcaagagagaacagcaagccccgagccagcctgaagccc
cggaaagtgtgttcagggggtaagaggaagaaggatgagattagcgtggacagtttggac
ttcaataagaagatccttcacacagcctggcaccccatggagagcattattgctgtagct
gccaccaataacttgtatatattccaggacaaaattaattaa

DBGET integrated database retrieval system