KEGG   Rattus norvegicus (rat): 24626Help
Entry
24626             CDS       T01003                                 

Gene name
Pde4b, PDE4/IVb, Pde4B1, Pde4B2, Pde4B3, Pde4B4, Pde4b5
Definition
(RefSeq) phosphodiesterase 4B
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04024  cAMP signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    24626 (Pde4b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24626 (Pde4b)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    24626 (Pde4b)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    24626 (Pde4b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     24626 (Pde4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDE4_UCR
Motif
Other DBs
NCBI-GeneID: 24626
NCBI-ProteinID: NP_058727
RGD: 3280
Ensembl: ENSRNOG00000005905
UniProt: P14646
Position
5q33
AA seq 721 aa AA seqDB search
MTAKNSSKELPASESEVCIKTFKEQMRLELELPKLPGNRPTSPKISPRSSPRNSPCFFRK
LLVNKSIRQRRRFTVAHTCFDVENGPSPGRSPLDPQASSSSGLVLHAAFPGHSQRRESFL
YRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRIVRNNFTLLTNLHGAPNK
RSPAASQAPVTRVSLQEESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLN
RELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLM
HSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQER
DLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLE
ILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIF
QNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQV
LRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQ
VGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDERSRDCQGLM
EKFQFELTLEEEDSEGPEKEGEGPNYFSSTKTLCVIDPENRDSLEETDIDIATEDKSLID
T
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaaaaattcttccaaagaacttccagcttctgaatctgaggtttgcataaag
actttcaaggagcagatgcgcttggaacttgagcttccaaagctaccaggaaacagacct
acatctcccaaaatttctccacgcagttcaccaaggaattcaccatgctttttcagaaag
ttgctggtgaataaaagcatccgacagcggcgtcgcttcactgtggctcatacatgcttt
gatgtggaaaatggcccttctccaggtcggagcccactggaccctcaagccagctcttct
tcaggactggtacttcatgccgccttccctgggcacagccaacgcagagagtcttttctc
tacagatccgacagcgactatgacttgtcaccaaaagcgatgtcaaggaactcctcactt
cccagcgaacaacacggcgatgacctgattgtcactccttttgcccaggttcttgccagc
ttgcgaatcgtaagaaacaatttcaccctgctgacaaaccttcacggagcaccgaacaag
aggtcgccagcggctagtcaggctccagtcaccagagtcagcctgcaagaagaatcatat
cagaaactagcaatggagacgctggaggaactagactggtgcctagaccagctagagacc
atccagacctaccgctctgtcagcgagatggcttcaaacaagttcaaaaggatgctgaac
cgggagctgacacacctctcagagatgagcagatcagggaaccaagtgtctgaatacatt
tcgaacacgttcttagacaagcagaacgatgtggaaatcccatctcccacccagaaggac
agggagaagaagaagaagcagcagctcatgacccagataagtggagtgaagaaactgatg
cacagctcaagcctgaacaacacaagcatctcacgctttggagtcaacacggaaaatgag
gatcatctagccaaggagctggaagacctgaacaaatggggccttaacatcttcaacgtg
gctgggtactcccataatcggcccctcacatgcatcatgtacgccattttccaggaaaga
gaccttctaaagacgtttaaaatctcctccgacaccttcgtaacctacatgatgacttta
gaagaccattaccattctgatgtggcgtatcacaacagcctgcacgctgctgacgtggcc
cagtcaacgcacgttctcctctctacgccagcactggatgctgtcttcacagacctggaa
atcctggctgccatttttgcagctgccatccatgatgttgatcatcctggagtctccaat
cagtttctcatcaatacaaattccgaacttgctttgatgtataatgacgaatctgtgctg
gaaaaccatcacctcgctgtgggattcaagctccttcaagaggaacattgcgacatcttt
cagaatcttaccaagaagcaacgccagacactcaggaaaatggtgattgacatggtgtta
gcaactgatatgtccaagcacatgagcctcctggctgaccttaaaacgatggtagaaacc
aaaaaggtgacgagctccggtgttctcctcctggacaactatactgaccggatacaggtt
cttcgcaacatggtacattgtgcagacctgagcaaccctaccaagtccttggagttgtat
cggcaatggactgatcgcatcatggaggagtttttccaacagggagacaaagaacgggag
aggggaatggagattagcccaatgtgtgataaacacacagcttctgtggaaaagtcccag
gttggtttcattgactacattgtccatccattgtgggagacctgggcagacctggttcag
cctgatgctcaagacattttggacacactagaagataacaggaactggtaccagagtatg
attccccagagcccctctccaccactggacgagaggagcagggactgccaaggccttatg
gagaagtttcagttcgaactgacccttgaagaagaggattctgaaggaccggaaaaggag
ggagaaggccccaactatttcagcagcacaaagacactttgtgtgatcgatccagagaac
agggattctctggaagagactgacatagacattgccacagaagacaagtctctgatcgac
acataa

DBGET integrated database retrieval system