KEGG   Rattus norvegicus (rat): 24627Help
Entry
24627             CDS       T01003                                 

Gene name
Pde4d
Definition
(RefSeq) phosphodiesterase 4D
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04024  cAMP signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    24627 (Pde4d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24627 (Pde4d)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    24627 (Pde4d)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    24627 (Pde4d)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     24627 (Pde4d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDE4_UCR
Motif
Other DBs
NCBI-GeneID: 24627
NCBI-ProteinID: NP_001106799
RGD: 3281
Ensembl: ENSRNOG00000042536
UniProt: P14270
Position
2q14
AA seq 803 aa AA seqDB search
MEAEGSSVPARAGSDEGSDSSGGAALKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQLQPPPPPPLPPPPPPPGATRGRYASSGASRVRHRGYSDTERYLYCRAMDRTS
YAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQANFVHS
QRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFAALTN
LQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSVSEMAS
NKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQHEVEIPSPTQKEKEKKKRPMSQIS
GVKKLMHSSSLTNSCIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMH
TIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEA
VFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQE
ENCDIFQNLTKKQRQSLRKMAIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNY
SDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNA
SVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDDQED
GRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVE
EEAVAEEESQPQTGVADDCCPDT
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagagggcagcagcgtgccggcccgggcgggcagcgacgagggcagcgacagc
tctggaggggccgcgctcaaagcccccaagcatctctggaggcacgagcagcaccaccag
tacccgctccggcagccccagttccgcctcttgcacccccatcaccacctgcccccgccg
ccgccaccctcgccccagccccagctgcagccaccaccaccgcccccactgccaccaccc
ccgccaccgcccggagctacccgtggtcgctacgcctcaagcggggctagccgcgtccgg
caccgcggctactcggacacggagcgctacctgtactgccgtgccatggaccgcacctcc
tacgcggtggagactggtcaccggccaggcctgaagaaatctaggatgtcctggccctcg
tctttccagggactcagacgtttcgatgtggacaatggcacatcagcgggacggagtccc
ttggatcccatgaccagcccagggtctgggctaattctccaagcaaactttgtgcacagt
caacgccgggagtccttcctgtatcgatcagacagcgattatgacctctctccaaagtct
atgtccaggaactcctcgattgccagtgatatacatggagatgacttgattgtgactcca
tttgctcaggtcttggccagccttcgaactgtaagaaacaactttgctgcattaactaat
ttgcaagatcgcgcacccagcaaaagatcacccatgtgcaaccaaccatccatcaacaaa
gccaccatcacagaggaggcctaccagaaactggccagcgagaccctggaggagctggac
tggtgtctggaccagctagagaccctgcagaccaggcactccgtcagtgagatggcctcc
aacaagttcaagaggatgcttaatcgggagctcacccacctctctgaaatgagtcggtct
ggcaaccaggtgtcggagtacatatcaaacacgttcttagataagcaacatgaagtagaa
attccctctccgactcagaaggaaaaagagaagaagaaaaggccgatgtcacagatcagt
ggggtcaagaagttgatgcacagctccagcctgaccaattcctgcattccaagatttggg
gttaaaacagagcaggaagatgtcctggccaaggaactagaagacgtgaacaagtggggc
ctccacgttttccgaatagcggagctgtctggcaaccggcctctgactgttatcatgcac
accatttttcaggaacgagatttgttaaaaacgtttaaaatcccagtggacactttgatt
acgtatcttatgactctagaagaccattaccatgctgacgtggcctatcacaacaacatc
catgctgcagatgtcgtccagtcaactcatgtgctgctctctacacccgctttggaggct
gttttcactgacttggagattctcgcggccatttttgccagtgcaatacatgatgtggat
catcctggtgtgtcaaatcaatttctgatcaatacaaactcggaacttgccttgatgtac
aacgactcctccgtcttagagaatcatcatttggctgtgggctttaagttgctccaggaa
gaaaactgtgacattttccagaatctgaccaaaaagcaaagacaatctttaaggaaaatg
gccattgacattgtactagcgacagacatgtcaaagcacatgaatctgctggctgatctg
aaaacaatggttgaaacgaagaaggtgacgagctctggcgtcctcctccttgataactat
tctgacaggatccaggtcctccagaatatggtgcactgtgcagacctgagcaaccccaca
aagccactccagctctaccgccagtggacggaccggataatggaggagttcttccgtcag
ggggaccgggagcgtgagcgtggcatggagataagtcccatgtgtgacaagcacaacgcc
tctgtggaaaaatcacaggtgggcttcatagactacattgttcatccactctgggagaca
tgggcagacctcgtacatcccgacgcccaggacattttggacactttggaggacaatcgt
gagtggtaccagagcacaatcccccagagcccctcccctgcacctgatgaccaagaggac
ggccgtcagggacagactgaaaaattccagttcgaactaaccttagaggaagatggcgag
tcagacactgaaaaggacagtggaagtcaagtggaggaagacactagctgcagtgactct
aagactctgtgcacccaagactcagagtccactgaaattccccttgacgagcaggttgaa
gaggaggctgtagcagaagaggaaagccagccccaaactggcgtcgcagacgattgttgt
cctgacacgtaa

DBGET integrated database retrieval system