KEGG   Rattus norvegicus (rat): 24628Help
Entry
24628             CDS       T01003                                 

Gene name
Pdgfb, SIS, c-sis
Definition
(RefSeq) platelet derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04630  Jak-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05211  Renal cell carcinoma
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05231  Choline metabolism in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24628 (Pdgfb)
   04015 Rap1 signaling pathway
    24628 (Pdgfb)
   04010 MAPK signaling pathway
    24628 (Pdgfb)
   04630 Jak-STAT signaling pathway
    24628 (Pdgfb)
   04072 Phospholipase D signaling pathway
    24628 (Pdgfb)
   04151 PI3K-Akt signaling pathway
    24628 (Pdgfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24628 (Pdgfb)
   04540 Gap junction
    24628 (Pdgfb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24628 (Pdgfb)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    24628 (Pdgfb)
   05231 Choline metabolism in cancer
    24628 (Pdgfb)
   05206 MicroRNAs in cancer
    24628 (Pdgfb)
  09162 Cancers: Specific types
   05214 Glioma
    24628 (Pdgfb)
   05218 Melanoma
    24628 (Pdgfb)
   05211 Renal cell carcinoma
    24628 (Pdgfb)
   05215 Prostate cancer
    24628 (Pdgfb)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    24628 (Pdgfb)
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    24628 (Pdgfb)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24628 (Pdgfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24628 (Pdgfb)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24628 (Pdgfb)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   24628 (Pdgfb)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   24628 (Pdgfb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF PDGF_N
Motif
Other DBs
NCBI-GeneID: 24628
NCBI-ProteinID: NP_113712
RGD: 3283
Ensembl: ENSRNOG00000017197
UniProt: Q05028 G3V882
Position
7q34
AA seq 241 aa AA seqDB search
MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAEL
DLNMTRAHSGVESESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKC
ETVVTPRPVTRSPGTSREHRAKTPQTRVTVRTVRIRRPPKGKHRKFKHTHDKKALKEILG
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgcctctctgctgctacctgcgtctggtcagcgct
gagggggatcccattcctgaggaactctatgaaatgctgagtgaccactccatccgctcc
tttgatgaccttcagcgcctgctgcacagagactccgtagacgaagatggggctgagctg
gacttgaacatgacccgagcacattctggagtcgagtcggaaagctcatctcgagggagg
aggagcctagggtctctggctgcagcagagcctgccgtaatcgccgagtgcaagacgcgt
acagaggtgttccagatctcgcggaacctcatcgatcgcaccaatgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctcgggctgctgcaataaccgcaatgtgcag
tgccgggcctcgcaggtgcagatgcggccggtgcaggtgagaaagatcgaaattgtgaga
aagaagccagtcttcaagaaggccacagtgaccctggaggaccatctggcctgcaagtgt
gagacagtagtgacccctcggcccgtgactcgaagtcctgggacatccagggagcatcga
gccaagacacctcaaactcgggtgaccgttcggacggtgcgaatccgccggccccccaaa
gggaagcaccgaaagtttaagcacacccatgacaagaaggcactgaaggagatccttgga
gcctag

DBGET integrated database retrieval system