KEGG   Rattus norvegicus (rat): 246281
Entry
246281            CDS       T01003                                 

Gene name
Asmt
Definition
(RefSeq) acetylserotonin O-methyltransferase
  KO
K00543  acetylserotonin O-methyltransferase [EC:2.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00380  Tryptophan metabolism
rno01100  Metabolic pathways
Module
rno_M00037  Melatonin biosynthesis, animals, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    246281 (Asmt)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.4  acetylserotonin O-methyltransferase
     246281 (Asmt)
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_11 Methyltransf_12 MTS
Other DBs
NCBI-GeneID: 246281
NCBI-ProteinID: NP_653360
RGD: 708472
Ensembl: ENSRNOG00000001324
UniProt: B3GSH5
Position
12q11
AA seq 432 aa
MAPGREGELDRDFRVLMSLAHGFMVSQVLFAALDLGIFDLAAQGPVAAEAVAQTGGWSPR
GTQLLMDACTRLGLLRGAGDGSYTNSALSSTFLVSGSPQSQRCMLLYLAGTTYGCWAHLA
AGVREGRNQYSRAVGISAEDPFSAIYRSEPERLLFMRGLQETWSLCGGRVLTAFDLSRFR
VICDLGGGSGALAQEAARLYPGSSVCVFDLPDVIAAARTHFLSPGARPSVRFVAGDFFRS
RLPRADLFILARVLHDWADGACVELLGRLHRACRPGGALLLVEAVLAKGGAGPLRSLLLS
LNMMLQAEGWERQASDYRNLATRAGFPRLQLRRPGGPYHAMLARRGPRPGIITGVGSNTT
GTGSFVTGIRRDVPGARSDAAGTGSGTGNTGSGIMLQGETLESEVSAPQAGSDVGGAGNE
PRSGTLKQGDWK
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggcacccggccgggagggcgagcttgaccgcgacttccgagtccttatgagcctcgcc
cacggcttcatggtctcccaggtgctgtttgctgccctggatctgggcatcttcgacctt
gcggcccagggcccggtggcagcggaggcggtggcacagactggggggtggagtccgcgg
ggaacgcagctgctaatggacgcctgcaccaggctggggctactaagaggggccggggac
ggctcctacaccaactctgcgctgtcatccacattcctggtgagcggaagcccccagtct
caacgctgcatgctgctctacctggcgggcacaacatacggctgctgggcccacctggct
gctggggtcagggaagggcggaaccagtactccagggccgtgggcatctccgctgaggac
cccttttcggccatctacaggtcagagcctgagcgcctgctgttcatgaggggcctgcag
gagacatggagtctatgcgggggacgggtcctcacagcctttgacctctcacgcttccgg
gtcatctgtgaccttggcggcgggtctggggcgctggcacaggaggccgcccgcctctat
cccggtagctccgtgtgtgtctttgatctccctgatgtcatcgccgctgcccgcacccac
ttcctgtcgccaggggcaagacccagtgtgaggtttgtcgctggtgacttcttccgttcc
cgcctcccccgcgctgacctcttcattcttgcccgggtcctgcacgactgggctgatggt
gcctgcgtggagttgctggggcggctgcacagggcctgcaggccaggtggtgcactactg
ctggtggaggcagtgctggccaagggcggggctgggccgctgcggtcgctcctgctgtca
ctcaacatgatgctgcaggctgaggggtgggagcgccaggccagcgactaccgcaacctg
gccactcgtgcaggcttcccccgcctgcagctgcggcgtcctggtgggccataccatgcc
atgctggcccggcggggaccccgccctgggatcatcacaggagtgggaagtaacactacg
gggacaggaagttttgtcacaggtataagacgtgatgtccctggggcaagaagtgacgct
gcagggacaggaagtggcactggaaacacaggaagtggcatcatgctacagggagagacg
ttggaatcagaggtcagcgccccacaagcaggaagtgacgttggcggggcaggaaatgaa
cccagaagtggcaccctcaagcaaggagactggaagtga

DBGET integrated database retrieval system