KEGG   Rattus norvegicus (rat): 24629Help
Entry
24629             CDS       T01003                                 

Gene name
Pdgfrb, PDGFR-1
Definition
(RefSeq) platelet derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04630  Jak-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24629 (Pdgfrb)
   04015 Rap1 signaling pathway
    24629 (Pdgfrb)
   04010 MAPK signaling pathway
    24629 (Pdgfrb)
   04630 Jak-STAT signaling pathway
    24629 (Pdgfrb)
   04020 Calcium signaling pathway
    24629 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    24629 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    24629 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24629 (Pdgfrb)
   04540 Gap junction
    24629 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24629 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24629 (Pdgfrb)
   05206 MicroRNAs in cancer
    24629 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    24629 (Pdgfrb)
   05231 Choline metabolism in cancer
    24629 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    24629 (Pdgfrb)
   05218 Melanoma
    24629 (Pdgfrb)
   05215 Prostate cancer
    24629 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    24629 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24629 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24629 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    24629 (Pdgfrb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     24629 (Pdgfrb)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   24629 (Pdgfrb)
CD molecules [BR:rno04090]
 Proteins
  24629 (Pdgfrb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ig Ig_3 I-set Ig_2 V-set C2-set_2 Ig_6 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 24629
NCBI-ProteinID: NP_113713
RGD: 3285
Ensembl: ENSRNOG00000018461
UniProt: Q05030
Position
18q12.1
AA seq 1097 aa AA seqDB search
MGLPEVMPASVLRGQLLLFVLLLLGPQISQGLVITPPGPEFVLNISSTFVLTCSSSAPVM
WEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVP
DPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIG
TFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGND
VVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHG
DEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSS
AGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLE
LSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVT
FWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFKVVVISAILAL
VVLTVISLIILIMLWQRKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSTELYSNALP
VGLSLPSHLNLTGESDGGYMDMSKDESVDYVPMLDMKGHIKYADIESSSYMAPYDNYVPS
APERTYRATLINDSPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGLHSLRSPLDTSSVLYTAVQPNETDNDY
IIPLPDPKPDAADEGLLEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQAEPEAQLEQP
QDSGCPGPLAEAEDSFL
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atggggcttccagaggtgatgccagcttcagtcctcagaggccaattgttgctgttcgtg
ctattgctcctgggaccacagatctcccaaggcctagtcatcacgccccctgggccagag
ttcgtcctcaacatttcgagcacctttgttctgacatgctcaagttcagctccagtgatg
tgggaacagatgtcccaggtgccctggcaagaagcagccatgaaccaggatggcaccttc
tccagtgtgctgacactgactaatgtcactgggggagacaccggagaatacttttgtgtc
tacaacaactcactggggccagagctcagtgagcggaagcgcatctatatctttgtgcca
gatcccaccatgggcttcctcccgatggactctgaggacctattcatttttgtcacggat
gtcactgagacgacgattccatgccgagtgacagacccccagctggaggtgacgctgcat
gagaagaaagtggatatccccctacatgtaccctatgaccaccagcgaggtttcattggt
acttttgaggacaagacttacatttgcaaaaccaccattggggacagggaagtggactcc
gatacttactatgtctacagcctgcaggtgtcatccatcaatgtctctgtgaatgcagtg
cagactgtggtccgccagggcgagagcatcaccatcaggtgcatcgtgatgggcaatgat
gtggtcaacttccagtggacgtacccccgcatgaagagtgggcggctggtggagccggtg
acagattacctcttcggagtgccctcccgcattggctccattcttcatatccccaccgct
gagctgagtgactctggcacctatacttgcaacgtgtcagtgagtgtgaatgaccacggc
gatgagaaagccatcaacgttactgtgatcgaaaatggctatgtgcggctgctggaaaca
ctggaagacgtacaaattgctgagctgcaccggagccggacgttgcaggtggtgtttgag
gcttatccgacgccctctgtcctgtggttcaaggacaaccgtaccttgggtgactccagc
gctggcgagttggttctgtccactcgcaacgtgtctgagacccggtatgtgtcagaactg
accttggtacgtgtgaaggtgtcagaagcgggctactataccatgcgggccttccatgcg
gacgaccaggtccagctctcattcaagctgcaggtcaatgtccctgtccgtgtactggag
ctgagtgagagtcatcctgccaatggggagcagatactccgctgtcggggccggggcatg
cctcagccaaatgtcacctggtctacctgcagagacctcaaaaggtgtccgcgaaaactg
tcacccacacccttggggaatagttccaaggaggagagccagctagaaacgaacgtgact
ttctgggaggaagatcaggaatatgaggtggtgagcacgctgcgcctgcgtcacgtggac
cagccactgtcagtgcgctgtatgctgcagaactcgatgggcagagattcacaagaggtc
accgtggtaccacactccttgcctttcaaagtggtggtgatctcagccatcttggccttg
gtggtccttactgtcatctctctcatcatcctcatcatgctgtggcagaggaaaccacgc
tatgagatccgatggaaggtcattgagtctgtgagctctgacggccatgagtacatctat
gtggatcctgtgcagttgccttacgactccacctgggagctgccacgggaccagcttgtt
ctgggacgcactcttggctctggggctttcggacaggtggtggaggccaccgctcatggt
ctgagccactcacaagccaccatgaaagtggctgtcaagatgctgaaatctacagccaga
agcagtgagaagcaagccctcatgtcggagttgaagatcatgagtcatctcggaccccac
ctgaacgtggtcaacctgctgggggcctgtaccaaaggagggcccatctacattatcacg
gaatactgccgttatggtgacctggtggactacctgcaccgaaacaaacacaccttcctg
caacgacactccaacaagcattgtccacccagcactgagctctacagcaacgccctgccg
gtggggctctccctacccagccacttgaacctgactggggagagcgacggtggttacatg
gacatgagcaaggatgaatctgtagattacgtgcccatgttggacatgaaaggacacatc
aaatacgcggacatcgagtcctccagctacatggccccttacgataactatgtcccatct
gcccctgaaaggacctatcgtgctaccttaatcaacgactcaccagtgctcagctacaca
gacctcgtgggcttcagttaccaagtggccaatggcatggaattcttggcctctaagaac
tgtgttcaccgagacctggcggccaggaatgtgctcatctgtgagggcaagttggtcaag
atctgtgactttggcctggctcgagacatcatgcgggactcaaactacatctccaaaggc
agtactttcctgcctctgaagtggatggccccagagagcatcttcaacagcctctacacc
accttgagtgatgtgtggtcctttggaatcctactctgggaaatcttcacactgggtggc
accccttacccagagctgcccatgaacgaccagttctacaatgccatcaagaggggctac
cgcatggcccaacctgctcatgcctccgacgagatctatgagatcatgcagaaatgctgg
gaagaaaagtttgagactcggccccccttctctcagctggtgctgctcctggagaggctt
ctgggtgaaggctataaaaagaagtaccagcaggtggatgaggagtttctgaggagtgac
catccagccatcctgaggtcccaagcccgcttgccgggtctccacagcctccgatcccct
ctggataccagctctgtcctctacactgctgtgcagcctaatgagactgacaatgactac
atcatccccttgcctgaccccaagcctgatgctgctgatgagggcctcctagagggttcc
cccagccttgccagctccaccttgaatgaagtcaacacttcttccaccatctcctgcgac
agccccctggagctccaagaagagccgcaagcagagcctgaggcacagctggagcagcca
caggattcaggctgcccaggacctctggctgaggcagaggacagcttcctgtag

DBGET integrated database retrieval system