KEGG   Rattus norvegicus (rat): 246296
Entry
246296            CDS       T01003                                 

Gene name
Lrrc15, Lib
Definition
(RefSeq) leucine rich repeat containing 15
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 LRR_9 LRR_1
Other DBs
NCBI-GeneID: 246296
NCBI-ProteinID: NP_659551
RGD: 70551
Ensembl: ENSRNOG00000038539
UniProt: Q8R5M3
Position
11q22
AA seq 578 aa
MPLKHYLLLLVGCQAWALGLAYYGCPSECTCSRASQVECTGARIVAMPTPLPWNAMSLQV
VNTHITELPENLFLNISALIALKMEKNELSTIMPGAFRNLGSLRYLSLANNKLRMLPIRV
FQDVNNLESLLLSNNQLVQIQPAQFSQFSNLRELQLHGNNLESIPEEAFDHLVGLTKLNL
GRNSFTHLSPRLFQHLGNLQVLRLHENRLSDIPMGTFDALGNLQELALQENQIGTLSPGL
FHNNRNLQRLYLSNNHISQLPPGIFMQLPQLNKLTLFGNSLRELSPGVFGPMPNLRELWL
YNNHITSLADNTFSHLNQLQVLILSHNQLTYISPGAFNGLTNLRELSLHTNALQDLDSNV
FRSLANLQNISLQSNRLRQLPGSIFANVNGLTTIQLQNNNLENLPLGIFDHLVNLCELRL
YDNPWRCDSDILPLHNWLLLNRARLGTDTLPVCSSPANVRGQSLVIININFPGPSVQGPE
TPEVPSYPDTPSYPDTTSVSSTTEITSAVDDYTDLTTIEATDDRNTWGMTEAQSGLAIAA
IVIGIIALACSLAACICCCCCKKRSQAVLMQMKAPNEC
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgccgctgaaacattacctcctcttgctggtgggctgccaggcctgggctctaggtttg
gcctactatggctgccccagtgaatgcacctgttcccgggcctcccaggtggagtgcaca
ggagcgcggattgtggcgatgcctacccccctgccctggaatgctatgagcctgcaggtc
gttaacacgcacattactgagctccctgagaacctgttcctcaacatttcagcgctcatt
gccctaaagatggagaagaatgagctgtcaaccatcatgccgggtgccttccgcaatctg
ggctctctgcgctacctcagcctcgccaacaacaaactgaggatgctgcccatcagggtc
ttccaggacgtaaacaatctggagtcccttctgctctccaataaccagctggtgcagatc
cagccagcccagttctcccagtttagtaatcttagggaactccagttgcatggcaacaat
ctggaatccattcccgaagaagccttcgaccacctagtaggactcaccaaactcaacctg
ggcaggaacagcttcacccacctatcgcctaggctctttcagcatctgggcaacctccag
gtgctccggctacacgagaacaggctttcagacatccccatgggcacgttcgatgcactc
ggcaacctccaggagcttgccctccaagagaaccagattggcaccctctcccctggcttg
ttccacaataaccgtaacctccagagactgtatctgtccaacaaccacatctcccagctg
ccccctggcatcttcatgcagctgccccagcttaacaagctcacactctttgggaattcc
ctgagggagctttccccgggggtcttcgggcccatgcccaacctgagggagctttggctc
tacaacaaccacatcacctccctcgccgacaacaccttcagccacctgaaccagctgcag
gtcctgattctcagtcacaaccagctcacttacatctccccaggagccttcaatgggctg
acgaacctccgagaactgtccctccacaccaacgctctacaggacctggacagcaacgtc
ttccgatcgctggccaacctgcagaacatctcgctccagagtaaccgcctccgacagctt
ccgggcagcatctttgccaacgtcaacggcctcacaaccatccaactgcagaacaacaat
ctagaaaacttgcctttgggcatctttgatcacttggtgaacctgtgtgagcttcgcctc
tacgacaacccctggagatgtgactcagatatcctcccacttcataactggctccttctc
aacagagccaggctggggacagacactcttccagtgtgttccagtcccgccaacgtccga
ggccagtccctcgtcatcatcaatatcaatttccctggacccagtgtccagggcccagag
acccctgaagtacctagttacccagatacgcccagctatcccgacaccacatctgtttcc
tctaccacggagatcaccagcgccgtcgacgactacaccgatctaaccaccattgaagcc
accgatgaccgaaatacgtggggcatgactgaggcccagagcgggctggccattgctgcc
atcgtgatcggcatcatagctttggcctgttccctagccgcctgcatctgctgctgctgc
tgcaaaaagaggagccaagcagtcctgatgcagatgaaggctcccaatgagtgctag

DBGET integrated database retrieval system