KEGG   Rattus norvegicus (rat): 246314Help
Entry
246314            CDS       T01003                                 

Gene name
Tor1aip1, Lap1b, Lap1c
Definition
(RefSeq) torsin 1A interacting protein 1
  KO
K23001  torsin-1A-interacting protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    246314 (Tor1aip1)
Chaperones and folding catalysts [BR:rno03110]
 Other chaperones and cochaperones
  Others
   246314 (Tor1aip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LAP1C 60KD_IMP DUF5336 DotU
Motif
Other DBs
NCBI-GeneID: 246314
NCBI-ProteinID: NP_659560
RGD: 628851
Ensembl: ENSRNOG00000003946
UniProt: Q5PQX1
Position
13q22
AA seq 583 aa AA seqDB search
MAGERWRAEGLGEGWAIYVTPRAPIREGRRRLATQNGDGSDAPAYETHPSRHGRREVRFS
EEPPEVYGDFEPRAAKERSPGERRTPPEKFRSDSAKEEVRESAYNLRSRQRRQRGPQEAE
EMKTRRSTRLEQHSQQAQQQLSPATSGRGLRDAQSLSEDRGEDEPSSQPVTSQTVSKKTV
RTPETSVMSEDPISNLCRPPLRSPRPDASIVQHINPFEEGETEDDLESSYSDVTIRIRSR
DSVESRDEAAVAAGHHPDSLWGLPHSRGDFTAHENQPSLLPTGCQKNPQEWVEQAVRMRT
RMAYNNIQKSDFGNQSPSTSRQQAAVQPPDESSVKIKWWLLILVAALAMGIYWFFHTPVV
ETTAVQEFQNQMKQLQSKYQSQDEKLWKRGTTFLEKHLNSSLPRPQPAILLLTAAQDAAE
VLKCLSEQIADAYSSFRSVRAIRIDGAGKAAQDSDLVKHEVDQELTDGFRNGQNAAVVHR
FESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEQTLEASLGLKEIEEKVRDFLKVKF
TSSDTANSYNHMDPDKLNGLWSRISHLVLPVQPENALKAGSCL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagagaggtggcgggccgaggggctgggagaaggatgggccatctacgtcaca
cccagagcccccatccgggagggaaggcggaggctcgccactcaaaatggcgacgggagt
gacgcgcctgcgtacgaaactcatccgtcgcgccacggacgacgggaagtgaggttttca
gaagagccgccagaagtgtacggcgacttcgagccccgggcggccaaagaaaggtctccg
ggggaaagacgaaccccgccagaaaagttccggtcggattctgcgaaagaggaagtgaga
gaaagcgcttacaatcttcggtctcgacaacggaggcagcggggaccccaggaagccgag
gagatgaagacgcggaggtctactcgtctggagcagcactcacagcaggcgcagcagcag
ctgtcaccggctacgagcgggcgaggattacgggacgctcagtccttaagtgaggaccgc
ggagaggatgaaccttcttcccaacctgttacaagccaaacagtctcaaagaaaactgtc
aggacaccagagacttcagtgatgagtgaagatcctatcagtaacttatgcagaccccca
ttaagaagcccaagacctgacgcttccattgtccaacacatcaacccctttgaggaagga
gaaaccgaagatgatcttgagagctcttacagtgatgtcactatcaggatcagatccagg
gactctgtcgagtctagagatgaagccgcagtagcagccggtcaccatccagactcactg
tgggggttaccacacagtcggggggacttcacagctcatgagaatcaaccctcactgctg
cccacaggatgtcaaaaaaaccctcaagagtgggttgaacaagctgtgagaatgaggact
agaatggcatataacaacattcagaaatcagactttggaaaccaatctccatcaacctcc
aggcaacaagcagctgtacaacccccagatgagtcttctgtcaagataaaatggtggctg
ctgatacttgttgctgctctggccatgggaatatattggttctttcatactcctgtagta
gaaaccactgctgttcaagaattccagaaccagatgaagcagctccagtctaagtaccag
agtcaagatgagaaactgtggaagagaggcacaacattcctagaaaaacatctgaatagc
tccctccctcggccccagcctgccatcctgctgctcactgcagctcaggatgctgcggaa
gtgctcaagtgtctgagtgaacagatcgccgatgcctactcttccttccgcagtgtccgt
gccatccggatcgacggagcaggcaaagctgctcaagacagtgacctcgttaagcacgaa
gtcgatcaggaactgacagatggatttagaaatggccagaatgcagctgtggtccaccgc
ttcgaatccctgcctgcaggctcaaccttgatcttctataaatactgtgaccatgaaaac
gcagccttcaaagatgtggccctcgtcttgacggtactgttggaggagcagacgctggaa
gccagtctaggcctaaaggaaattgaggagaaagtgagggatttccttaaagtcaagttc
accagctctgacacggccaactcctacaaccacatggacccagacaagctcaatggactc
tggagccgcatctcccacctcgtgctgcccgtgcagcctgagaatgctctgaaagcaggc
agctgcttatga

DBGET integrated database retrieval system