KEGG   Rattus norvegicus (rat): 246325Help
Entry
246325            CDS       T01003                                 

Gene name
Kcnh8, ELK3, Elk1, Ets-1
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 8
  KO
K04911  potassium voltage-gated channel Eag-related subfamily H member 8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    246325 (Kcnh8)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   246325 (Kcnh8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PAS_9 Ion_trans_2 cNMP_binding PAS_3 PAS_4 PAS DUF2959 SlyX LPP
Motif
Other DBs
NCBI-GeneID: 246325
NCBI-ProteinID: NP_659563
RGD: 2549
Ensembl: ENSRNOG00000058626
UniProt: Q9QWS8
Position
9q11
AA seq 1102 aa AA seqDB search
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKVEFKGEIMFYKKNGAPFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKITSEDKKEDRAKGRSRAGSHFDSARRRSRAVLYHISGHLQR
REKNKLKINNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVP
YNVCFIGNEDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLM
SMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRW
SLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLGLYPEYAHK
FVEDIQHDLTYNLREGHESDVISRLSNKSTVPQAEPKGNGSIKKRLPSIVEDEEEEEVEE
EETTSLSPIYTRGSSVSHSKKTGSSKSYLGLSLKQLTSGTVPFHSPIRVSSANSPKTKQE
ADPPNHGTRKEKNLKVQLCSLGTAGTPELSPRIVDGIEDGNSSEETQTFDFGSEQIRPEP
RISPSLGESEIGAAFLFIKAEETKQQINKLNSEVTTLTQEVSQLGKDMRSIMQLLENILS
PQQPSQFCSLHPTSICPSRESFQTRVSWSAHQPCLHLQANGAHLYHGNVTSDIWSVDPSL
VGSNPQRTEAHEQSPVDSELHHSPNLAYSPSHCQVIQEGHLQFLRCISPHSDTTLTPLQS
ISATLSSSVCSSSETSLHLVLPSRSEEGSITHGPVSSFSLENLPGSWDREGMMSASTEPL
ENFPVEVVTSTADVKDSKAINV
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgccggttatgaaaggattgctggcgccacagaacaccttcctggacactattgccacc
cgtttcgacggaacacatagcaacttcatcctggccaatgcccaagtggcaaaaggtttc
cccatagtctactgttcagatggcttctgtgagctggctgggtttgctcgaactgaagtc
atgcagaagagttgcagctgcaagtttctgtttggggtggagaccaacgagcagctgatg
cttcagatcgaaaagtccctggaggagaaggtagagttcaaaggagaaattatgttctac
aagaagaatggggctccattttggtgcctgttggatatcgttcctataaagaatgagaaa
ggagatgtggtccttttcctggcctcattcaaagatataacagacacgaaagtgaagatt
acttcagaagataaaaaagaagacagagccaaaggaagatcaagagcagggagccacttc
gactcagcccgcagacggagccgagcagtcctttatcacatctcaggacacctgcaaaga
agagaaaagaacaaattgaaaataaataataacgtgtttgtagataaaccggcgtttcca
gagtataaggtttccgatgcaaaaaagtccaagttcatcctgctgcacttcagcactttt
aaagctggctgggactggctcattttgctggcaacgttttatgttgctgtgacagtccct
tacaacgtgtgcttcattggcaatgaggatctgtccacaactcggagcacaacggtcagt
gacatcgctgtggagattctcttcattatagatattattctaaatttccgaacaacttat
gtcagcaagtctggccaagttatctttgaagcgagatccatttgcatccactacgtcacc
acctggttcatcattgatctgattgctgccctgccctttgacctcctgtatgctttcaat
gtcacagtggtgtccctcgtacatcttctgaagactgttcggctgctccgtcttttgcgc
ctcctgcagaagctggaccgttattctcagcacagcacaattgtcctcaccctgctcatg
tccatgtttgctctccttgcacactggatggcatgtatctggtatgtcattggaaaaatg
gagagggaggacaacagccttctcaagtgggaagtcggttggcttcacgagctgggaaag
agactggaatctccgtactacggcaacaacacgctgggcggcccgtccatccgcagtgcc
tatatcgcagccttgtacttcactctcagcagcctcaccagcgtgggatttgggaatgtg
tccgctaacacggatgcagagaagatcttctccatctgtaccatgttgattggagccctg
atgcatgccttggtatttgggaatgtgactgccatcatacagagaatgtactctagatgg
agcctgtaccatactagaaccaaggacctaaaggacttcatccgtgtgcatcacctgccc
cagcaactcaagcagaggatgcttgagtactttcagacaacttggtctgtcaacaatgga
atagattcaaatgagcttttgaaagactttccagatgagctgcgctctgacatcacaatg
catctgaacaaggagatcttacagctgtccctgtttgaatgtgctagccggggctgcctc
aggtctctgtctctccatattaaaacctcattctgtgccccaggagagtatctgctgcgc
cagggagatgcgttgcaggccatctacttcgtgtgctcaggctctatggaggttcttaaa
gacagcatggtgttggctattctagggaagggggatttaattggagcaaatttatcaatt
aaagaccaagtgatcaagaccaacgctgacgtgaaggctctgacctactgtgatctacag
tgcatcatcctgaaaggtctctttgaggtgctgggcctttacccagagtacgcacacaaa
ttcgtagaagacatccagcacgacctcacatacaaccttcgagaaggtcatgagagtgat
gtaatatcaagattatcgaacaaatctacagtcccacaggcagagcccaaggggaatgga
agcatcaagaagagactcccatccattgtggaagatgaggaagaggaggaagtggaggaa
gaggagaccacctccctttctcccatctacacaaggggatcctctgtttcacacagcaaa
aagactggaagcagtaagagctatctaggtttgagcttaaagcaactgacctcaggaaca
gttccattccactcacctatcagagtctccagtgccaactcccctaaaaccaagcaggaa
gctgacccacctaaccatggcacacggaaagagaagaatctgaaagttcagctctgcagc
ctgggtactgctggaaccccagagctcagtccgaggattgtcgatggaattgaagatggc
aacagcagtgaggaaactcagacttttgattttggctctgaacaaatcaggccagagccc
aggatttccccttcccttggagaatcagagattggagctgcgtttctgttcatcaaggct
gaagaaaccaagcagcagataaacaagctcaacagtgaggtcacaacattgactcaggag
gtctcccagctagggaaagatatgagaagcatcatgcaacttctggaaaacatcttgtca
cctcagcagccatcacaattttgttctctgcatcccacttcaatctgtccttccagagaa
agtttccagactagggtgagctggagtgctcaccagccttgcctacacttgcaggcaaat
ggagcacatctttaccatggcaatgtcacctctgacatctggagtgtcgacccctccttg
gtgggcagcaaccctcaacgaactgaagctcatgagcaaagtccagtagatagtgaactg
catcattctccaaacctggcttattccccctctcactgccaggttatccaagaaggccac
ttgcagttcctaaggtgcatctcccctcattcagataccacactgacacctttgcagtcc
atctcagccactctctcatcctctgtgtgctcctcatcagaaacatccttgcacctcgtt
ctcccaagtaggtcagaggagggcagcatcactcatggacctgtgagttctttcagtttg
gaaaacttaccaggatcttgggaccgagaaggaatgatgtcagcctctacagaacccttg
gagaactttccagtagaagttgtcacaagcacagcggatgtaaaagacagcaaagccata
aacgtataa

DBGET integrated database retrieval system