KEGG   Rattus norvegicus (rat): 246326Help
Entry
246326            CDS       T01003                                 

Gene name
Zdhhc2, DHHC2, srec
Definition
(RefSeq) zinc finger, DHHC-type containing 2
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    246326 (Zdhhc2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     246326 (Zdhhc2)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    246326 (Zdhhc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 246326
NCBI-ProteinID: NP_659564
RGD: 628681
Ensembl: ENSRNOG00000022686
UniProt: Q2TGK4
Position
16q12.1
AA seq 366 aa AA seqDB search
MAPSGPGGVRRRCRRVLYWIPVVFISLLLGWCYYAYAIQLCIVSMENIGEQVVCLMAYHL
LFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRT
MSGAIRYCDRCRLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLL
YCLFIAATDLQYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNKS
TLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSQGDGCSFPTCLVNQD
PEQPSTPAGLNSTAKNPENHQFPAKPLRESQSHLLTDSQTWTENSSNSGRCKAGMSNPAL
TMENET
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctcgggccccggtggcgtgaggcggcggtgccggcgggtgctctactggatc
cctgtggtgttcatcagcttgcttctgggctggtgctactatgcttacgcgatccagctg
tgcatagtgtccatggaaaacattggtgaacaagttgtgtgcctcatggcttatcatcta
cttttcgcaatgtttgtctggtcatactggaaaaccatttttacattgcccatgaatcct
tcaaaagaattccatctctcttatgcagagaaagaattgctggagagagagccaagagga
gaagcccatcaggaagttctgaggcgagcagccaaagaccttcccatctacaccaggacc
atgtccggcgcgatccgatattgtgacagatgccgacttataaagccagaccgctgccat
cactgttccgtctgtgataaatgtattttgaagatggaccatcattgcccatgggtgaac
aattgtgttggattttcaaattataaattcttcctccttttcttggcttactctctgctg
tactgccttttcattgctgctacagatttacagtattttatcagattttggacaaatggt
ctccctgatactcaagccaagttccatattatgtttttattctttgctgcagctatgttt
tctgtcagcttgtcctctctttttggttatcattgctggctagtcagcaaaaataaatct
acattagaggcattcagaaatccagtatttagacatggaacagataagaacggattcagc
ttgggtttcagtaaaaacatgcgacaagtttttggcgatgagaagaagtattggctgtta
ccaatattttcaagtcaaggtgatggctgttcctttccaacttgccttgttaaccaggat
cctgaacaaccttccactcctgcaggactaaattcaacagcgaaaaatcctgaaaaccat
cagtttcctgcaaagccgttgagagagtcacagagccacctccttacggattctcagacc
tggacagagaacagttcaaactccgggagatgcaaagccggtatgagcaaccctgcatta
actatggagaacgagacttaa

DBGET integrated database retrieval system