KEGG   Rattus norvegicus (rat): 246334
Entry
246334            CDS       T01003                                 

Gene name
Tp63, Ket, P73l, Tp73l, Trp63
Definition
(RefSeq) tumor protein p63
  KO
K10149  tumor protein p63
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    246334 (Tp63)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    246334 (Tp63)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    246334 (Tp63)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 Forkhead_N Mtf2
Other DBs
NCBI-GeneID: 246334
NCBI-ProteinID: NP_062094
RGD: 620863
Ensembl: ENSRNOG00000001924
UniProt: Q9JJP6
Position
11q22
AA seq 680 aa
MNFETSRCATLQYCPDPYIQRFIETPSHFSWKESYYRSAMSQSTQTSEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSENGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNGM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSAKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSMQSQSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTMPEGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHDFSSPPHLLRTPSGASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND
FNFDMDSRRNKQQRIKEEGE
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgaattttgaaacttcacggtgtgctaccctacagtactgccctgacccttacatccag
cgtttcatagaaaccccatctcatttctcctggaaagaaagttattaccggtccgccatg
tcgcagagcacccagacaagtgagttcctcagcccagaggtgttccagcatatctgggat
tttctggaacagcctatatgctcagtacagcccatcgacttgaactttgtggacgaacca
tcagaaaatggtgcaacaaacaagattgagattagcatggattgtatccgcatgcaagac
tcagacctcagtgaccccatgtggccacagtacacgaacctggggctcctgaacggcatg
gaccagcagattcagaacggctcctcatctaccagcccctataacacagaccatgcacag
aacagcgtgacggcaccctcgccctatgcacagcccagctcaaccttcgatgccctttct
ccatcccctgccattccctccaacacagattacccaggcccacacagcttcgatgtgtcc
ttccagcagtcaagcaccgccaagtcagctacctggacgtattccaccgaactgaagaaa
ctctactgccagattgcaaagacctgccccatccagatcaaggtgatgaccccaccccca
cagggcgccgtcattcgtgccatgcctgtctacaagaaagccgagcatgtcaccgaggtt
gtgaaacgatgtcctaaccacgagctgagccgcgagttcaatgagggacagattgcccct
cccagtcatctgattcgagtagaagggaacagccatgcccagtatgtagaagatcctatc
acaggaaggcagagcgtgctggtcccttatgagccaccacaggttggcactgaattcaca
acagtcctgtacaatttcatgtgcaacagcagctgtgtcggaggaatgaaccgccgtcca
attttaatcatcgttactctggaaaccagagatgggcaagtcctgggccgacgttgcttt
gaggcccggatctgcgcttgcccaggaagagaccggaaggccgatgaagacagcatcaga
aagcagcaagtatcagacagcgcaaagaacggcgatggtacgaagcgccctttccgtcag
aatacccacggaatccagatgacttccatcaagaaacggagatccccagatgatgagctg
ctgtacctaccagtgagaggccgtgagacttatgaaatgctgctcaagatcaaggagtcg
ctcgagctcatgcagtatctccctcagcacacgatcgagacgtacaggcagcagcagcag
cagcagcaccaacacctacttcagaaacagacctcgatgcagtctcagtcttcatacggt
aacagctcaccacctctgaacaaaatgaacagcatgaacaagctgccgtctgtgagccag
cttatcaacccacagcagcgcaacgccctgactcccaccaccatgcctgagggcatggga
gccaacattcctatgatgggcactcacatgccaatggctggagacatgaatggactcagc
cccacccaagctcttcctcctccactctccatgccctccacctcccactgcaccccccca
cctccgtacccaacagactgcagcattgtcagtttcttagcaaggttgggctgttcatca
tgtctggactatttcacgacccaggggctgaccaccatctatcagattgagcattactcc
atggatgatttggcaagtctgaagatccctgagcagttccgacatgccatctggaagggg
atcctggaccacaggcagctgcatgacttctcctcacctccgcatctcctgagaaccccc
agtggtgcctctacagtcagtgtgggctccagtgagacccgtggagaacgtgtgattgat
gccgtgcgctttactctccgccagaccatctctttcccaccccgtgatgagtggaacgat
ttcaactttgacatggattcccgtcgcaacaagcagcagcgcatcaaagaggaaggagaa
tga

DBGET integrated database retrieval system