KEGG   Rattus norvegicus (rat): 24642
Entry
24642             CDS       T01003                                 

Gene name
Pgam1, PGAM-B, Pgmut
Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00260  Glycine, serine and threonine metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24642 (Pgam1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    24642 (Pgam1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    24642 (Pgam1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    24642 (Pgam1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24642 (Pgam1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24642 (Pgam1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     24642 (Pgam1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    24642 (Pgam1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   24642 (Pgam1)
  Exosomal proteins of melanoma cells
   24642 (Pgam1)
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-GeneID: 24642
NCBI-ProteinID: NP_445742
RGD: 3312
Ensembl: ENSRNOG00000050585
UniProt: P25113
Position
1q54
AA seq 254 aa
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKVKK
NT seq 765 nt   +upstreamnt  +downstreamnt
atggctgcctacaagctggtgctgatccggcatggcgagagcgcctggaacctggagaac
cgcttcagcggctggtacgatgccgacctgagcccagcgggccacgaggaggcgaagcgc
ggcgggcaggcgttgcgagatgctggctatgagtttgacatctgcttcacctctgtgcag
aagagagcaatccgcaccctctggacagtcctggatgccattgaccagatgtggttgcca
gtggtcaggacctggcgtctcaatgagcgacactatgggggtctaacaggtctcaataaa
gcagagactgctgctaagcatggtgaggcacaggtaaagatctggagacgatcttacgat
gtcccgccacctccaatggagcctgatcatcccttctacagcaacatcagcaaggaccgc
aggtacgcagaccttactgaggaccagctaccctcctgtgagagcctgaaggatactatt
gccagggcactgcccttctggaatgaagaaattgtcccccagatcaaggaggggaaaagg
gtcttgattgctgcccatggcaacagcctacggggcattgtcaagcatctggagggtctg
tcagaagaggccatcatggagctgaacctgccaactggcatccccatcgtctatgaactg
gacaagaacttgaagcccatcaagcccatgcagttcctgggagatgaggagaccgtgcgt
aaagccatggaagctgtggctgctcagggcaaggtgaagaagtga

DBGET integrated database retrieval system